BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0858 (750 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 23 2.6 AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 23 2.6 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 23 3.4 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 22 4.6 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 6.0 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 6.0 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +1 Query: 571 VKIFFKIHSKK*EEYY*KLXECHFLNSI*FPKKMF 675 V IFF +KK E++ + + HF ++ ++F Sbjct: 68 VTIFFNFATKKLEQFIVRFMKYHFFGTLKLWSQLF 102 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 181 RRNTDRNA*NLSNSTFYNYLTSHY 252 RRN + A + N FY++L++ Y Sbjct: 234 RRNFSKQASEILNEYFYSHLSNPY 257 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +3 Query: 501 LLVKRFXSLEGNYSLKNFRRTSVCKN 578 +LVK F +++ TS+CKN Sbjct: 503 MLVKSFDAIDSKLQTGGKVETSICKN 528 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 22.2 bits (45), Expect = 4.6 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = +2 Query: 647 IQYNFLKKCFGINII 691 + YNF KKC+ + ++ Sbjct: 47 LNYNFTKKCYFLRMV 61 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 208 NLSNSTFYNYLTSHYLH 258 N + TF+N L YLH Sbjct: 1189 NRNEETFWNELIEQYLH 1205 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 208 NLSNSTFYNYLTSHYLH 258 N + TF+N L YLH Sbjct: 1189 NRNEETFWNELIEQYLH 1205 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,329 Number of Sequences: 336 Number of extensions: 2728 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -