BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0857 (700 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g15460.1 68414.m01858 anion exchange family protein member of... 29 2.2 At3g19970.1 68416.m02527 expressed protein 27 9.0 >At1g15460.1 68414.m01858 anion exchange family protein member of the PF|00955 Anion exchanger family Length = 683 Score = 29.5 bits (63), Expect = 2.2 Identities = 20/59 (33%), Positives = 27/59 (45%) Frame = +3 Query: 207 LRSKLANHYDS*DGWAIPFSASRGPPN*VHVWSATSEEEQNYLYSSTAQRTRVALPEDA 383 L+S+ A + GW F A G P V VW+A S + L S +R LP D+ Sbjct: 221 LKSRKARSWRYGTGWYRSFIADYGVPLMVVVWTALSFSTPSKLPSGVPRRLFSPLPWDS 279 >At3g19970.1 68416.m02527 expressed protein Length = 434 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -2 Query: 339 SKGSSVPPLTSPTKHVLS*EVPGKRRKVWPSHLRNRNDWL 220 SKG V T P ++S +V GK K S + + DWL Sbjct: 187 SKGYHVITFTLPMNEIMSYQVGGKAEKNIESLVNHLADWL 226 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,651,376 Number of Sequences: 28952 Number of extensions: 248425 Number of successful extensions: 557 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 545 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 557 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -