BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0850 (750 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30927| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 8e-10 SB_36233| Best HMM Match : Kelch_1 (HMM E-Value=0) 59 4e-09 SB_33046| Best HMM Match : RRM_1 (HMM E-Value=3.6e-13) 59 4e-09 SB_38405| Best HMM Match : BACK (HMM E-Value=0) 54 9e-08 SB_18403| Best HMM Match : BACK (HMM E-Value=0) 54 9e-08 SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0) 54 2e-07 SB_45623| Best HMM Match : BTB (HMM E-Value=1.4e-36) 53 2e-07 SB_38111| Best HMM Match : Kelch_1 (HMM E-Value=0) 53 2e-07 SB_33742| Best HMM Match : Kelch_1 (HMM E-Value=0) 53 2e-07 SB_13053| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_26836| Best HMM Match : BTB (HMM E-Value=1.1e-37) 52 4e-07 SB_8385| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_28350| Best HMM Match : BTB (HMM E-Value=1.1e-38) 52 7e-07 SB_49585| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_56342| Best HMM Match : Kelch_1 (HMM E-Value=0) 51 1e-06 SB_33725| Best HMM Match : Kelch_1 (HMM E-Value=3.59994e-42) 51 1e-06 SB_54052| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_5771| Best HMM Match : Kelch_1 (HMM E-Value=0) 48 1e-05 SB_33388| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_38976| Best HMM Match : BACK (HMM E-Value=3.09967e-42) 47 2e-05 SB_18446| Best HMM Match : Kelch_1 (HMM E-Value=0) 46 2e-05 SB_19151| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_2806| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_48518| Best HMM Match : Kelch_1 (HMM E-Value=0) 45 8e-05 SB_12977| Best HMM Match : BTB (HMM E-Value=1.7e-30) 44 1e-04 SB_55145| Best HMM Match : Kelch_1 (HMM E-Value=0) 44 1e-04 SB_4030| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_2676| Best HMM Match : Kelch_1 (HMM E-Value=0) 44 1e-04 SB_15301| Best HMM Match : Kelch_1 (HMM E-Value=0) 44 2e-04 SB_8489| Best HMM Match : Kelch_1 (HMM E-Value=1.2e-30) 42 4e-04 SB_54322| Best HMM Match : Kelch_1 (HMM E-Value=0) 42 4e-04 SB_19932| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_9607| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_39453| Best HMM Match : BTB (HMM E-Value=3.1e-36) 41 0.001 SB_36561| Best HMM Match : BACK (HMM E-Value=1.4013e-45) 40 0.002 SB_48929| Best HMM Match : BTB (HMM E-Value=1.4e-15) 40 0.003 SB_6593| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_22964| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_49590| Best HMM Match : BTB (HMM E-Value=4.8e-06) 38 0.011 SB_49953| Best HMM Match : BTB (HMM E-Value=2.9e-18) 37 0.015 SB_5391| Best HMM Match : BTB (HMM E-Value=1.1e-09) 36 0.027 SB_37574| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_17029| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.061 SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_40807| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_1926| Best HMM Match : PH (HMM E-Value=1.4e-23) 33 0.33 SB_46137| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.43 SB_51669| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.57 SB_37912| Best HMM Match : BTB (HMM E-Value=3.6e-13) 32 0.57 SB_40853| Best HMM Match : BTB (HMM E-Value=1.4e-17) 31 0.76 SB_29786| Best HMM Match : I-set (HMM E-Value=0) 31 0.76 SB_11280| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.00 SB_53179| Best HMM Match : BTB (HMM E-Value=3.3e-21) 31 1.3 SB_40804| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_35938| Best HMM Match : BTB (HMM E-Value=8.5e-24) 30 1.7 SB_25077| Best HMM Match : BTB (HMM E-Value=1.4e-10) 30 1.7 SB_2930| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_34102| Best HMM Match : Kelch_1 (HMM E-Value=0) 30 2.3 SB_38411| Best HMM Match : PHR (HMM E-Value=1.8e-28) 29 3.0 SB_663| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_4008| Best HMM Match : Fer4 (HMM E-Value=0.16) 29 5.3 SB_24495| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_13953| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_32554| Best HMM Match : BTB (HMM E-Value=2e-13) 28 7.0 SB_46547| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_43996| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 >SB_30927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 501 Score = 61.3 bits (142), Expect = 8e-10 Identities = 29/69 (42%), Positives = 44/69 (63%) Frame = +3 Query: 396 FCMGNYISEFMKMMFTMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKEC 575 F + N+ +E ++MM +R + L DV+L VG F H++VLA S Y +AMFT+G+ E Sbjct: 7 FQIPNHSNEALQMMNELRKKRELCDVLLHVGGREFRGHRIVLAGASSYLRAMFTNGMLES 66 Query: 576 EMSRVRLQG 602 M ++LQG Sbjct: 67 GMRDIKLQG 75 >SB_36233| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 571 Score = 58.8 bits (136), Expect = 4e-09 Identities = 29/70 (41%), Positives = 42/70 (60%) Frame = +3 Query: 387 DMTFCMGNYISEFMKMMFTMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGL 566 D TFC+ M+ M R + L DV L V LFH H+ +LAA SPYF+A+FTS + Sbjct: 5 DATFCVNA-----MQSMDDFRKERFLCDVTLNVNEVLFHAHRNILAASSPYFRALFTSEM 59 Query: 567 KECEMSRVRL 596 +E + + ++L Sbjct: 60 RENQGNEIKL 69 >SB_33046| Best HMM Match : RRM_1 (HMM E-Value=3.6e-13) Length = 1463 Score = 58.8 bits (136), Expect = 4e-09 Identities = 29/70 (41%), Positives = 42/70 (60%) Frame = +3 Query: 387 DMTFCMGNYISEFMKMMFTMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGL 566 D TFC+ M+ M R + L DV L V LFH H+ +LAA SPYF+A+FTS + Sbjct: 1374 DATFCVNA-----MQSMDDFRKERFLCDVTLNVNEVLFHAHRNILAASSPYFRALFTSEM 1428 Query: 567 KECEMSRVRL 596 +E + + ++L Sbjct: 1429 RENQGNEIKL 1438 >SB_38405| Best HMM Match : BACK (HMM E-Value=0) Length = 423 Score = 54.4 bits (125), Expect = 9e-08 Identities = 31/69 (44%), Positives = 38/69 (55%) Frame = +3 Query: 396 FCMGNYISEFMKMMFTMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKEC 575 FC + F M MR + L DVVL VG+ + H++VLAA S YF AMFTS L E Sbjct: 20 FCPTHTEEAFFSMK-QMRCNSELCDVVLLVGDRRIYAHRLVLAACSQYFHAMFTSELLES 78 Query: 576 EMSRVRLQG 602 + LQG Sbjct: 79 RQKEISLQG 87 >SB_18403| Best HMM Match : BACK (HMM E-Value=0) Length = 423 Score = 54.4 bits (125), Expect = 9e-08 Identities = 31/69 (44%), Positives = 38/69 (55%) Frame = +3 Query: 396 FCMGNYISEFMKMMFTMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKEC 575 FC + F M MR + L DVVL VG+ + H++VLAA S YF AMFTS L E Sbjct: 20 FCPTHTEEAFFSMK-QMRCNSELCDVVLLVGDRRIYAHRLVLAACSQYFHAMFTSELLES 78 Query: 576 EMSRVRLQG 602 + LQG Sbjct: 79 RQKEISLQG 87 >SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 823 Score = 53.6 bits (123), Expect = 2e-07 Identities = 23/52 (44%), Positives = 35/52 (67%) Frame = +3 Query: 444 MRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKECEMSRVRLQ 599 +R + L DVV++VG+ H H+VVLAA SPYF+AMFT + E + + ++ Sbjct: 52 LRQCEELCDVVIKVGSSTIHAHRVVLAACSPYFRAMFTREMAESRQAEITIR 103 >SB_45623| Best HMM Match : BTB (HMM E-Value=1.4e-36) Length = 574 Score = 53.2 bits (122), Expect = 2e-07 Identities = 32/73 (43%), Positives = 42/73 (57%), Gaps = 1/73 (1%) Frame = +3 Query: 426 MKMMFTMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKECEMSRVRLQG- 602 +K + R ++L DVVL V NE F HK +LAA S YF AMFT+ + E E RV L+ Sbjct: 28 LKSLNDQRQSKILCDVVLLVENEEFSAHKGILAANSHYFMAMFTTDMIEKEQERVILKKL 87 Query: 603 RVSFSDGLADILY 641 + S + D LY Sbjct: 88 KPSVVKEILDFLY 100 >SB_38111| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 548 Score = 53.2 bits (122), Expect = 2e-07 Identities = 27/83 (32%), Positives = 49/83 (59%), Gaps = 1/83 (1%) Frame = +3 Query: 408 NYISEFMKMMFTMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKECEMSR 587 NY M+ + R H +L +V + V + F+ H+ VLAA SPYF+AMF+S +E S+ Sbjct: 31 NYCVALMQCLNDFRKHNVLCEVTIVVNGKPFYAHRNVLAAASPYFRAMFSSHFREQNESK 90 Query: 588 VRLQGRVSFSDGLADIL-YVHGG 653 + ++ +D + ++L +++ G Sbjct: 91 PVILENIT-ADVMEELLNFIYAG 112 >SB_33742| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 570 Score = 53.2 bits (122), Expect = 2e-07 Identities = 27/83 (32%), Positives = 49/83 (59%), Gaps = 1/83 (1%) Frame = +3 Query: 408 NYISEFMKMMFTMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKECEMSR 587 NY M+ + R H +L +V + V + F+ H+ VLAA SPYF+AMF+S +E S+ Sbjct: 31 NYCVALMQCLNDFRKHNVLCEVTIVVNGKPFYAHRNVLAAASPYFRAMFSSHFREQNESK 90 Query: 588 VRLQGRVSFSDGLADIL-YVHGG 653 + ++ +D + ++L +++ G Sbjct: 91 PVILENIT-ADVMEELLNFIYAG 112 >SB_13053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 581 Score = 52.8 bits (121), Expect = 3e-07 Identities = 30/67 (44%), Positives = 39/67 (58%), Gaps = 4/67 (5%) Frame = +3 Query: 408 NYISEFMKMMFTM----RSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKEC 575 N +EF + F R+ + L DV+L V +E HK+VLAA SPYF+AMFTS L EC Sbjct: 10 NTCTEFASVAFQQFNDFRNSKELCDVLLCVDDEEIPSHKLVLAASSPYFRAMFTSNLLEC 69 Query: 576 EMSRVRL 596 + L Sbjct: 70 TQRTITL 76 >SB_26836| Best HMM Match : BTB (HMM E-Value=1.1e-37) Length = 521 Score = 52.4 bits (120), Expect = 4e-07 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 1/67 (1%) Frame = +3 Query: 444 MRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKECEMSRVRLQGRVSFS-D 620 +R + D VL+V + F +HK+V++A SPYF+ +F+ GL+E + V +QG S + Sbjct: 27 LRRLNTMCDAVLKVEEKQFPIHKIVVSASSPYFEVLFSGGLRESYLDTVTIQGIDSETFS 86 Query: 621 GLADILY 641 L D +Y Sbjct: 87 ALLDFIY 93 >SB_8385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 580 Score = 52.0 bits (119), Expect = 5e-07 Identities = 26/63 (41%), Positives = 39/63 (61%) Frame = +3 Query: 411 YISEFMKMMFTMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKECEMSRV 590 + ++ ++M ++R ML DVVL+ G+ H+VVLA+ SPYF AMFT L E + V Sbjct: 23 HCNKAFQVMNSLRQQNMLCDVVLKAGSIEIPAHRVVLASSSPYFFAMFTGELSESRQTVV 82 Query: 591 RLQ 599 L+ Sbjct: 83 TLK 85 >SB_28350| Best HMM Match : BTB (HMM E-Value=1.1e-38) Length = 518 Score = 51.6 bits (118), Expect = 7e-07 Identities = 27/65 (41%), Positives = 37/65 (56%) Frame = +3 Query: 402 MGNYISEFMKMMFTMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKECEM 581 +G++ +E + +R L DV L V E H+VVLAA SPYF+AM T+G E M Sbjct: 18 LGSHENEAFSVFKELRDDGELLDVTLHVQGEEIKAHRVVLAACSPYFRAMLTTGFAETFM 77 Query: 582 SRVRL 596 S + L Sbjct: 78 STIPL 82 >SB_49585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 51.2 bits (117), Expect = 9e-07 Identities = 28/91 (30%), Positives = 49/91 (53%), Gaps = 1/91 (1%) Frame = +3 Query: 372 SNEIGDMTFCMGNYISEFMKMMFTMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAM 551 S++ ++ + + + + +R L DVVL+V + F H++VLA+ S YF AM Sbjct: 7 SSKCDSSSYLTSGHAKDILTSVNKLRKDGKLCDVVLQVEKKEFPAHRIVLASCSDYFYAM 66 Query: 552 FTSGLKECEMSRVRLQGRVSFS-DGLADILY 641 FT+ + E + + LQG S + + L D +Y Sbjct: 67 FTNDMLESQKGVIELQGLASDTMEVLLDFVY 97 >SB_56342| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 651 Score = 50.8 bits (116), Expect = 1e-06 Identities = 24/71 (33%), Positives = 39/71 (54%) Frame = +3 Query: 390 MTFCMGNYISEFMKMMFTMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLK 569 + FC+ ++ ++ + +RS + L DV L V + H+VVLA SPYF AM T + Sbjct: 7 LLFCVPDFPTKVFSSLNELRSEEKLCDVTLVVKDRSLVSHRVVLAGWSPYFHAMLTGDML 66 Query: 570 ECEMSRVRLQG 602 E + +V + G Sbjct: 67 ESRLEKVTIHG 77 >SB_33725| Best HMM Match : Kelch_1 (HMM E-Value=3.59994e-42) Length = 635 Score = 50.8 bits (116), Expect = 1e-06 Identities = 28/78 (35%), Positives = 44/78 (56%), Gaps = 1/78 (1%) Frame = +3 Query: 411 YISEFMKMMFTMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKECEMSRV 590 Y E ++ M R L DV L V F H++VLAAGSP+F +FT+ +KE + +++ Sbjct: 16 YCGEMLQRMNGYRVAHSLCDVDLMVEGLTFSAHRLVLAAGSPFFHGLFTTEMKEKQENKI 75 Query: 591 RL-QGRVSFSDGLADILY 641 L Q + S + + + LY Sbjct: 76 VLKQVKASVMENVLEYLY 93 >SB_54052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 48.4 bits (110), Expect = 6e-06 Identities = 19/53 (35%), Positives = 33/53 (62%) Frame = +3 Query: 441 TMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKECEMSRVRLQ 599 ++R +L D V+++G + VHK VL A SP+F+ +FT+ ++E + LQ Sbjct: 27 SLRKENVLCDAVIQIGGKTHPVHKNVLCAASPFFRGLFTNDMQEKNQEHIELQ 79 >SB_5771| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 595 Score = 47.6 bits (108), Expect = 1e-05 Identities = 25/57 (43%), Positives = 33/57 (57%) Frame = +3 Query: 387 DMTFCMGNYISEFMKMMFTMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFT 557 ++ F N+ +K + MR H +LTDVVL V F HK +LAA S YF AMF+ Sbjct: 8 ELKFVDENHNDFLVKRIGRMRYHSILTDVVLIVDGHEFPAHKNILAASSDYFMAMFS 64 >SB_33388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 658 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/44 (47%), Positives = 29/44 (65%) Frame = +3 Query: 468 DVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKECEMSRVRLQ 599 DV+L+V + VH+ VLAA SP+F MF SG+KE ++LQ Sbjct: 57 DVILQVEGRHYPVHRCVLAANSPFFYTMFNSGMKESMQQTLQLQ 100 >SB_38976| Best HMM Match : BACK (HMM E-Value=3.09967e-42) Length = 603 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/43 (48%), Positives = 30/43 (69%) Frame = +3 Query: 468 DVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKECEMSRVRL 596 DV LEV ++F H+ VLAA S +F MFTSG+++ SR++L Sbjct: 53 DVNLEVEGQVFAAHRCVLAANSQFFYTMFTSGMRDSNDSRIKL 95 >SB_18446| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 571 Score = 46.4 bits (105), Expect = 2e-05 Identities = 28/79 (35%), Positives = 40/79 (50%), Gaps = 1/79 (1%) Frame = +3 Query: 408 NYISEFMKMMFTMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKECEMSR 587 +Y E + + R L DV L VGN F HK VL A S +F +F+S ++E + + Sbjct: 2 DYCRELLHTLNEFRLENHLCDVELIVGNNRFAAHKNVLCASSIFFNGLFSSSMRERQENT 61 Query: 588 VRL-QGRVSFSDGLADILY 641 V L Q V+ + L LY Sbjct: 62 VNLKQFPVNIMEDLLTYLY 80 >SB_19151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 613 Score = 46.4 bits (105), Expect = 2e-05 Identities = 29/71 (40%), Positives = 40/71 (56%), Gaps = 2/71 (2%) Frame = +3 Query: 435 MFTMRSHQMLTDVVLEVGNEL-FHVHKVVLAAGSPYFKAMFTSGLKECEMSRVRLQGRVS 611 +F+ + L DV LE + L VH+ VLAA SPYF+AMFT L E +R+ L+G Sbjct: 72 LFSQIGLKELCDVTLETEDGLSIAVHRNVLAAVSPYFRAMFTGNLLESGKNRILLKGIAG 131 Query: 612 FS-DGLADILY 641 + L D +Y Sbjct: 132 VALQALLDYVY 142 >SB_2806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 600 Score = 46.0 bits (104), Expect = 3e-05 Identities = 22/66 (33%), Positives = 35/66 (53%) Frame = +3 Query: 399 CMGNYISEFMKMMFTMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKECE 578 C + + FM+ R + L D+ + +G++ HK+VLA+ S YF AMFT + E Sbjct: 13 CSTHMVKTFMRFE-DFRKNSQLCDIKIVIGDKRIRAHKLVLASFSDYFSAMFTGDMAETS 71 Query: 579 MSRVRL 596 + V L Sbjct: 72 QNTVHL 77 >SB_48518| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 481 Score = 44.8 bits (101), Expect = 8e-05 Identities = 24/58 (41%), Positives = 33/58 (56%) Frame = +3 Query: 426 MKMMFTMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKECEMSRVRLQ 599 + +M +R + L DV L VG H++VLA+ S YF+AMFT GL E V L+ Sbjct: 34 LMVMDDLRGRKQLCDVTLCVGERQIVAHRLVLASFSSYFQAMFTGGLVESFEDSVTLR 91 >SB_12977| Best HMM Match : BTB (HMM E-Value=1.7e-30) Length = 176 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/59 (42%), Positives = 34/59 (57%) Frame = +3 Query: 420 EFMKMMFTMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKECEMSRVRL 596 EF++ + MR DV L+V ++ F HK+VLAA S YF+AMF G E + V L Sbjct: 18 EFLQTLDKMRVSGEGCDVTLKVTDQSFPGHKLVLAANSTYFRAMFGEGFVESSKNDVVL 76 >SB_55145| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 625 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/74 (28%), Positives = 38/74 (51%) Frame = +3 Query: 381 IGDMTFCMGNYISEFMKMMFTMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTS 560 I + T+ + S+ ++ + + L DV ++ G H+VVLA+ S YF +MFT+ Sbjct: 6 IQEFTYEANDLPSQAFTILTQLLEQEKLCDVTIKAGERKIRCHRVVLASCSAYFHSMFTN 65 Query: 561 GLKECEMSRVRLQG 602 + E + +QG Sbjct: 66 SMLESSQEVITIQG 79 >SB_4030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 809 Score = 44.4 bits (100), Expect = 1e-04 Identities = 20/58 (34%), Positives = 35/58 (60%) Frame = +3 Query: 426 MKMMFTMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKECEMSRVRLQ 599 ++ + T+ + + DV + VG H+++LAA S YF +MFTSG+ E +R+ L+ Sbjct: 23 LETLRTLFQGRKMCDVTVVVGKMEIPSHRLILAANSSYFYSMFTSGMSETAQNRINLK 80 >SB_2676| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 645 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/53 (43%), Positives = 31/53 (58%) Frame = +3 Query: 444 MRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKECEMSRVRLQG 602 +R + L DV L VGN H+VVL+A S YF AMFT L E + + ++G Sbjct: 25 LRQRKELCDVELCVGNVQISAHRVVLSACSAYFDAMFTGNLLESKKQVIYIKG 77 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +2 Query: 650 GKIRITEVTVXQLLPAXTMXQITNVINACSAXL 748 GK IT+ V LLPA M Q+ V +AC L Sbjct: 93 GKAEITQENVQLLLPAANMLQLYKVKDACCQFL 125 >SB_15301| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 590 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/70 (31%), Positives = 34/70 (48%) Frame = +3 Query: 393 TFCMGNYISEFMKMMFTMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKE 572 TF Y + + +R H + DVV++ + F H+ +L+A S YF AMF +KE Sbjct: 10 TFYDDKYSKAILHRINQLRHHGAMCDVVIKAEDTEFLAHRNILSASSDYFFAMFNGNMKE 69 Query: 573 CEMSRVRLQG 602 V + G Sbjct: 70 SSQDVVTITG 79 >SB_8489| Best HMM Match : Kelch_1 (HMM E-Value=1.2e-30) Length = 619 Score = 42.3 bits (95), Expect = 4e-04 Identities = 24/51 (47%), Positives = 33/51 (64%) Frame = +3 Query: 420 EFMKMMFTMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKE 572 EF++ + MR DV L+V ++ F HK+VLAA S YF+AMF GL+E Sbjct: 60 EFLQTLDKMRVSGEGCDVTLKVTDQSFPGHKLVLAANSTYFRAMF--GLRE 108 >SB_54322| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 587 Score = 42.3 bits (95), Expect = 4e-04 Identities = 26/67 (38%), Positives = 35/67 (52%), Gaps = 1/67 (1%) Frame = +3 Query: 444 MRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKECEMSRVRLQG-RVSFSD 620 +R L DV L V + F H++VLAA S YF +FTS + E V+LQ R S + Sbjct: 23 IRQECKLCDVTLVVEGKEFPAHRIVLAASSKYFYGLFTSEMIEKNAPSVKLQELRASVMN 82 Query: 621 GLADILY 641 + LY Sbjct: 83 HILTYLY 89 >SB_19932| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2201 Score = 41.5 bits (93), Expect = 7e-04 Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 1/82 (1%) Frame = +3 Query: 411 YISEFMKMMFTMRSHQMLTDVVLEVGNE-LFHVHKVVLAAGSPYFKAMFTSGLKECEMSR 587 Y + + + + D+ L+ +E +F HK+VLAA S YFKA+FT+ + E Sbjct: 11 YRKSVTSQLMQYQESESMCDITLKTTSEDIFPAHKIVLAAKSDYFKALFTTEMAEKNCQE 70 Query: 588 VRLQGRVSFSDGLADILYVHGG 653 + L +S A + YV+ G Sbjct: 71 ISLD--ISTRTLKAILKYVYCG 90 >SB_9607| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 41.5 bits (93), Expect = 7e-04 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = +3 Query: 465 TDVVLEVGNELFHVHKVVLAAGSPYFKAMFTS 560 +D++LEV + F+VHK++L SP FKAMF S Sbjct: 28 SDIILEVEEQEFYVHKMILKMASPVFKAMFDS 59 >SB_39453| Best HMM Match : BTB (HMM E-Value=3.1e-36) Length = 398 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/54 (37%), Positives = 27/54 (50%) Frame = +3 Query: 435 MFTMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKECEMSRVRL 596 M + + +D VL G F HK +LAA SP F AMF ++E RV + Sbjct: 213 MGNLLDNATFSDTVLIAGGREFKAHKAILAARSPVFSAMFEHEMEESRKGRVEI 266 >SB_36561| Best HMM Match : BACK (HMM E-Value=1.4013e-45) Length = 554 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/59 (38%), Positives = 34/59 (57%), Gaps = 2/59 (3%) Frame = +3 Query: 429 KMMFTMRSHQMLTDVVL--EVGNELFHVHKVVLAAGSPYFKAMFTSGLKECEMSRVRLQ 599 K M R + DVVL E G E+ HK+VL+A S YF+AMF + +KE + + ++ Sbjct: 14 KQMNAFRCDGIFCDVVLMTEDGQEI-DAHKLVLSASSEYFRAMFLTDMKESQQKFITIR 71 >SB_48929| Best HMM Match : BTB (HMM E-Value=1.4e-15) Length = 239 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/30 (56%), Positives = 21/30 (70%) Frame = +3 Query: 465 TDVVLEVGNELFHVHKVVLAAGSPYFKAMF 554 +DV+L V + FHVHK +L SP FKAMF Sbjct: 18 SDVILVVEEQEFHVHKFILKMASPVFKAMF 47 >SB_6593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 39.1 bits (87), Expect = 0.004 Identities = 24/82 (29%), Positives = 37/82 (45%) Frame = +3 Query: 411 YISEFMKMMFTMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKECEMSRV 590 + E + + R+ ++L DV L HKVVLAA SPYF+ +F + + V Sbjct: 30 FSDELCAFLQSQRNDEVLCDVTLRHNERRIPCHKVVLAARSPYFRHLFINSESGQYVKNV 89 Query: 591 RLQGRVSFSDGLADILYVHGGR 656 L S I Y++ G+ Sbjct: 90 ELPSYFSILAVDEVINYLYSGK 111 >SB_22964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1506 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/44 (40%), Positives = 26/44 (59%) Frame = +3 Query: 441 TMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKE 572 T+ + LTDV V F H+V+LAA S YF+A+ G++E Sbjct: 24 TLYQSRELTDVTFIVEKTKFTAHRVILAARSEYFRALLFGGMRE 67 >SB_49590| Best HMM Match : BTB (HMM E-Value=4.8e-06) Length = 89 Score = 37.5 bits (83), Expect = 0.011 Identities = 18/54 (33%), Positives = 28/54 (51%) Frame = +3 Query: 435 MFTMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKECEMSRVRL 596 ++ R+ L DV ++V + VH+ VLAA +F +F S LKE + L Sbjct: 1 LYGFRATSHLCDVSIDVNGRISPVHRAVLAANEGFFGGLFESNLKENNQDVIHL 54 >SB_49953| Best HMM Match : BTB (HMM E-Value=2.9e-18) Length = 123 Score = 37.1 bits (82), Expect = 0.015 Identities = 16/36 (44%), Positives = 24/36 (66%) Frame = +3 Query: 444 MRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAM 551 MR++ D+ L+ GN + H+VVLAA SPYF+ + Sbjct: 34 MRTNSEHCDITLKAGNLVLSAHRVVLAALSPYFREL 69 >SB_5391| Best HMM Match : BTB (HMM E-Value=1.1e-09) Length = 367 Score = 36.3 bits (80), Expect = 0.027 Identities = 15/50 (30%), Positives = 27/50 (54%) Frame = +3 Query: 450 SHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKECEMSRVRLQ 599 ++ D +L +GN+ F H LA S YF+A+F + +E M + ++ Sbjct: 66 NNSRFADKILCIGNQRFFCHSDYLALRSEYFRALFNNEFRENSMDEIAIE 115 >SB_37574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 35.5 bits (78), Expect = 0.046 Identities = 17/46 (36%), Positives = 26/46 (56%) Frame = +3 Query: 462 LTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKECEMSRVRLQ 599 L DVVL + + + H+ VLA+ S YF AMF L E + + ++ Sbjct: 11 LCDVVLRIDEQSYAGHRAVLASCSAYFYAMFNGELAESKQKIITMK 56 >SB_17029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 434 Score = 35.1 bits (77), Expect = 0.061 Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 3/81 (3%) Frame = +3 Query: 414 ISEFMKMMFTMRSHQMLTDVVLEVGNELFHV--HKVVLAAGSPYFKAMFTSGLKECEMSR 587 I E + MF H + V++ EL + HK +LA GSP F++ F + E + Sbjct: 10 IRERTQYMFNNALHSDIEFAVVKSNGELDKIPAHKFILAIGSPVFESQFHGPMAEKDCRT 69 Query: 588 VRLQGRVSFSDGLADIL-YVH 647 + G V +GL + L YV+ Sbjct: 70 INYNGTV---EGLLEFLRYVY 87 >SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4527 Score = 33.1 bits (72), Expect = 0.25 Identities = 25/82 (30%), Positives = 39/82 (47%), Gaps = 2/82 (2%) Frame = +3 Query: 315 DDLPPISCDSNFEDSAGSGSNEIGDMTFCMGNYISEFMKMMFTMRSHQMLTDVVLEVGN- 491 D +SC+ EDS GS+ + D F ++ + + MR + L DV++ N Sbjct: 3539 DSKQKMSCNK-LEDSHVYGSHLVSDDRF--RRFV---FRELNEMRKREFLCDVIILADNG 3592 Query: 492 -ELFHVHKVVLAAGSPYFKAMF 554 F H+ VLAA S YF ++ Sbjct: 3593 CRRFPAHRAVLAASSRYFHKLY 3614 >SB_40807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 32.7 bits (71), Expect = 0.33 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +3 Query: 414 ISEFMKMMFTMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFT 557 +S K + + +DVVL FH +K +L+A YFK MF+ Sbjct: 95 VSSLKKDFQELLENAYCSDVVLLYSGSRFHANKAILSARCSYFKDMFS 142 >SB_1926| Best HMM Match : PH (HMM E-Value=1.4e-23) Length = 998 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/61 (24%), Positives = 32/61 (52%) Frame = +3 Query: 408 NYISEFMKMMFTMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKECEMSR 587 +++S +K + + + +D+ + G + HK VLAA S ++ + + + E E+S Sbjct: 751 SFVSRLLKTVADLYDKDLYSDITVSFGGQKIKAHKFVLAARSDHWCSRDLNEVTELELSD 810 Query: 588 V 590 V Sbjct: 811 V 811 >SB_46137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 646 Score = 32.3 bits (70), Expect = 0.43 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = +3 Query: 390 MTFCMGNYISEFMKMMFTMRSHQMLTDVVLEVGNELFHVHKVVLAAGSP 536 +TF N+ ++++ R DV+LEVG+ H+ +L+A P Sbjct: 13 LTFSRENHEKRLLELLNEQRKATKFCDVLLEVGDSEIAAHRAILSASIP 61 >SB_51669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 646 Score = 31.9 bits (69), Expect = 0.57 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 1/68 (1%) Frame = +3 Query: 456 QMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSG-LKECEMSRVRLQGRVSFSDGLAD 632 + ++DV ++G + H HKV+L + S AMF G E VRL+ + LA Sbjct: 447 ECMSDVAFDLGVVVVHAHKVMLVSQSEMLAAMFMEGHFLEGGRQSVRLRD-TNHDHFLAL 505 Query: 633 ILYVHGGR 656 + +++ GR Sbjct: 506 LEFLYTGR 513 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +3 Query: 417 SEFMKMMFTMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYF 542 S F + + T+ + +DVV +GN+ H ++LAA SP F Sbjct: 253 SLFRENLKTIFHSSLCSDVVFLIGNQSIPAHAMLLAAMSPTF 294 >SB_37912| Best HMM Match : BTB (HMM E-Value=3.6e-13) Length = 470 Score = 31.9 bits (69), Expect = 0.57 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = +3 Query: 462 LTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKECEMSRVRLQG 602 ++DVVL V + HVH+ +LA S F+ MF L++ + L+G Sbjct: 1 MSDVVLLVEEQRMHVHQSILAMWSTVFEEMFNE-LRKKNSRALHLEG 46 >SB_40853| Best HMM Match : BTB (HMM E-Value=1.4e-17) Length = 259 Score = 31.5 bits (68), Expect = 0.76 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = +3 Query: 462 LTDVVLEVGNELFHVHKVVLAAGSPYFKAMF 554 L+D VL V + F+VHK L+ SP F+ MF Sbjct: 16 LSDAVLVVEEKHFNVHKSTLSMWSPVFEKMF 46 >SB_29786| Best HMM Match : I-set (HMM E-Value=0) Length = 6300 Score = 31.5 bits (68), Expect = 0.76 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 4/45 (8%) Frame = +3 Query: 450 SHQMLTDVVLEVGNE----LFHVHKVVLAAGSPYFKAMFTSGLKE 572 ++++L+DV VG E HK++LA SP F AMF + E Sbjct: 2756 NNKLLSDVSFRVGKEQGKYFIPGHKLILAISSPVFYAMFYGSMAE 2800 >SB_11280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 607 Score = 31.1 bits (67), Expect = 1.00 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = -3 Query: 535 GLPAANTTLWT*KSSFPTSNTTSVSIWCDLIVNIIFMNS 419 GL ++ T++ + SF TSN S IW D V +IF+ S Sbjct: 353 GLDRSSNTVFNYRKSFATSNLLSDEIWID--VTVIFIQS 389 >SB_53179| Best HMM Match : BTB (HMM E-Value=3.3e-21) Length = 604 Score = 30.7 bits (66), Expect = 1.3 Identities = 22/76 (28%), Positives = 34/76 (44%), Gaps = 1/76 (1%) Frame = +3 Query: 417 SEFMKMMFTMRSHQMLTDVVLEVGNELFHVHKVVLAAGSPYFKAMFTSGLKECEMSRVRL 596 S+ K +F R +++DVV V H HK ++ A S AMF E ++L Sbjct: 402 SKIAKEVFLNRP--LMSDVVFRVEGLQVHAHKGLIMARSEVMAAMFGGSFAESSNEEIKL 459 Query: 597 QGR-VSFSDGLADILY 641 + + GL + LY Sbjct: 460 KDTPLKAFIGLLEYLY 475 >SB_40804| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1044 Score = 30.3 bits (65), Expect = 1.7 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = -3 Query: 670 FSYPDLPPCT*SISARPSLKDTRPCNRTLDISH--SLRPLVNIALK*GLPAANT 515 F+ P + T S+ P KD C R LDI+H +L LV+ + G +ANT Sbjct: 328 FNLPSIDWATSSVP--PGAKDANLCRRLLDIAHDFNLEQLVHEPTRYGPTSANT 379 >SB_35938| Best HMM Match : BTB (HMM E-Value=8.5e-24) Length = 467 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 5/48 (10%) Frame = +3 Query: 444 MRSHQMLTDVVLEV----GNEL-FHVHKVVLAAGSPYFKAMFTSGLKE 572 M S+ + +D+ + G E+ F HK VL+ SP F+AMF L E Sbjct: 20 MYSNSLFSDIEFLITKADGTEVRFPAHKFVLSVSSPVFEAMFFGNLAE 67 >SB_25077| Best HMM Match : BTB (HMM E-Value=1.4e-10) Length = 292 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +3 Query: 465 TDVVLEV-GNELFHVHKVVLAAGSPYFKAMFT 557 +D VL V N+ FHVH LA SP F+ + T Sbjct: 58 SDAVLTVDNNQKFHVHTATLARVSPVFEELLT 89 >SB_2930| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 588 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +3 Query: 501 HVHKVVLAAGSPYFKAM-FTSGLKECEMSRVRL 596 HVH LA S YF+ + F+SG+KE +V + Sbjct: 236 HVHSFWLALNSSYFRGLFFSSGMKETRNKKVSI 268 >SB_34102| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 628 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +2 Query: 650 GKIRITEVTVXQLLPAXTMXQITNVINACSAXL 748 GKI I+E+ V ++LP + Q+ +V AC L Sbjct: 94 GKIEISELNVQEVLPIACLLQVQSVQEACCEFL 126 >SB_38411| Best HMM Match : PHR (HMM E-Value=1.8e-28) Length = 436 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 2/39 (5%) Frame = +3 Query: 444 MRSHQMLTDVVLEVGNELFHV--HKVVLAAGSPYFKAMF 554 M ++++L+DV VG++ + H+ VLA SP F AMF Sbjct: 27 MFNNELLSDVHFLVGSKKARIPAHRYVLAISSPVFFAMF 65 >SB_663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2028 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 4/43 (9%) Frame = +3 Query: 450 SHQMLTDVVLEVGN----ELFHVHKVVLAAGSPYFKAMFTSGL 566 ++++L+DV VG HK VL+ GS F AMF G+ Sbjct: 1604 NNEILSDVYFLVGKGPQRRRIPAHKFVLSIGSAVFDAMFNGGI 1646 >SB_4008| Best HMM Match : Fer4 (HMM E-Value=0.16) Length = 444 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = -3 Query: 691 EQLXDRHFSYPDLPPCT*SISARPSLKDTRPCNRTLDISHSLRPL 557 EQL R + Y LP CT SA PSLK + + L S ++P+ Sbjct: 327 EQLPAREYYY--LPHCTEKTSAAPSLKQWQEIFKGLGQSLHIQPV 369 >SB_24495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 415 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 507 HKVVLAAGSPYFKAMFTSGLKE 572 H+V+LAA +F+ TSG+KE Sbjct: 124 HRVILAARCDWFRRALTSGMKE 145 >SB_13953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 Query: 507 HKVVLAAGSPYFKAMFTSGLKE 572 HK VLA SP F+AMF L E Sbjct: 44 HKYVLATSSPVFEAMFFGKLAE 65 >SB_32554| Best HMM Match : BTB (HMM E-Value=2e-13) Length = 133 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 Query: 507 HKVVLAAGSPYFKAMFTSGLKE 572 HK VLA SP F+AMF L E Sbjct: 13 HKYVLATSSPVFEAMFFGKLAE 34 >SB_46547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1058 Score = 27.9 bits (59), Expect = 9.3 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 176 NFDFYVDNWLFLSETNIHWACIKATSNSK 262 N D+Y+D L+++ H CIK T SK Sbjct: 760 NIDYYMDLASKLAKSGTHILCIKVTPTSK 788 >SB_43996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1056 Score = 27.9 bits (59), Expect = 9.3 Identities = 15/41 (36%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = -2 Query: 425 ELTDVIS-HAECHIADLVGPTPGGILEVAVTTNRRQVIQHV 306 ++ DV S A+ + +DLV TPGG +E ++ + + V QH+ Sbjct: 837 QVCDVQSTSAQSYTSDLVLQTPGGAVEHSLASASKPVEQHL 877 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,710,328 Number of Sequences: 59808 Number of extensions: 482855 Number of successful extensions: 1769 Number of sequences better than 10.0: 66 Number of HSP's better than 10.0 without gapping: 1667 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1767 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -