BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0848 (700 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF321227-6|AAK16426.1| 150|Tribolium castaneum Pb protein. 25 0.79 AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia or... 25 0.79 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 23 2.4 AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 21 9.7 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 21 9.7 >AF321227-6|AAK16426.1| 150|Tribolium castaneum Pb protein. Length = 150 Score = 24.6 bits (51), Expect = 0.79 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -1 Query: 358 VEFCNAVGWLQGKSSRIKTMAQLIHNLGDIS 266 +E CN G++ + S + M L H GD++ Sbjct: 52 IEGCNETGFINSQPSMAEFMTALPHLSGDMT 82 >AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia ortholog protein. Length = 477 Score = 24.6 bits (51), Expect = 0.79 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -1 Query: 358 VEFCNAVGWLQGKSSRIKTMAQLIHNLGDIS 266 +E CN G++ + S + M L H GD++ Sbjct: 52 IEGCNETGFINSQPSMAEFMTALPHLSGDMT 82 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 23.0 bits (47), Expect = 2.4 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -1 Query: 304 TMAQLIHNLGDISGY*TACAVSGLQ 230 T A L+HNLG I+ T + LQ Sbjct: 92 TKADLVHNLGTIAKSGTKAFMEALQ 116 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 21.0 bits (42), Expect = 9.7 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +2 Query: 68 SHGDASSINVGAGYSIG 118 S GDAS+ ++G+G G Sbjct: 151 SPGDASNASIGSGEGTG 167 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 21.0 bits (42), Expect = 9.7 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +2 Query: 68 SHGDASSINVGAGYSIG 118 S GDAS+ ++G+G G Sbjct: 307 SPGDASNASIGSGEGTG 323 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,200 Number of Sequences: 336 Number of extensions: 3139 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -