BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1468 (732 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ850297-1|CAH64517.1| 539|Tribolium castaneum putative esteras... 22 4.4 AJ850295-1|CAH64515.1| 539|Tribolium castaneum putative esteras... 22 4.4 AJ850293-1|CAH64513.1| 539|Tribolium castaneum putative esteras... 22 4.4 AJ850292-1|CAH64512.1| 539|Tribolium castaneum putative esteras... 22 4.4 AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esteras... 22 5.9 AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 21 7.8 >AJ850297-1|CAH64517.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 22.2 bits (45), Expect = 4.4 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 292 NIGLFENVRFEFYHKIIKMNVLLLNVFTMYSVEK 393 N+GLF+ R +IK+ V LL F+ S+ K Sbjct: 453 NMGLFDTSRNHRDRAMIKIFVDLLTSFSDSSIPK 486 >AJ850295-1|CAH64515.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 22.2 bits (45), Expect = 4.4 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 292 NIGLFENVRFEFYHKIIKMNVLLLNVFTMYSVEK 393 N+GLF+ R +IK+ V LL F+ S+ K Sbjct: 453 NMGLFDTSRNHRDRAMIKIFVDLLTSFSDSSIPK 486 >AJ850293-1|CAH64513.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 22.2 bits (45), Expect = 4.4 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 292 NIGLFENVRFEFYHKIIKMNVLLLNVFTMYSVEK 393 N+GLF+ R +IK+ V LL F+ S+ K Sbjct: 453 NMGLFDTSRNHRDRAMIKIFVDLLTSFSDSSIPK 486 >AJ850292-1|CAH64512.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 22.2 bits (45), Expect = 4.4 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 292 NIGLFENVRFEFYHKIIKMNVLLLNVFTMYSVEK 393 N+GLF+ R +IK+ V LL F+ S+ K Sbjct: 453 NMGLFDTSRNHRDRAMIKIFVDLLTSFSDSSIPK 486 >AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.8 bits (44), Expect = 5.9 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +1 Query: 292 NIGLFENVRFEFYHKIIKMNVLLLNVFTMYSVEK 393 N+GLF+ R ++K+ V LL F+ S+ K Sbjct: 453 NMGLFDTSRNHRDRAMVKIFVDLLTSFSDSSIPK 486 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +1 Query: 343 KMNVLLLNVFTMYSVEKNTY 402 K+N L T++ VE TY Sbjct: 11 KLNTFFLKALTVWHVENPTY 30 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,025 Number of Sequences: 336 Number of extensions: 3139 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19571740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -