BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1460 (767 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 23 2.0 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 23 2.0 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 23.4 bits (48), Expect = 2.0 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +2 Query: 194 YINSERNPHLHGH--QYETTDTFYLHTTCPYESVKFEP 301 Y N + NP L + + T+ Y H Y SVK EP Sbjct: 16 YQNYKTNPFLASDCDKNQNTEHNYTHNNEMYHSVKEEP 53 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 23.4 bits (48), Expect = 2.0 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 74 NNHNHTKH*GYYIECYCTVKLYIHVPAHGA 163 NN NH H G++I V + HV A+G+ Sbjct: 318 NNQNHHHHAGHHIHAQHHVVNH-HVAANGS 346 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,135 Number of Sequences: 336 Number of extensions: 3063 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20650031 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -