BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1456 (1001 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 23 4.9 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 22 8.6 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 22.6 bits (46), Expect = 4.9 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +3 Query: 555 YLYYHSVKLFILENKTRNFNIVIFNQI 635 Y Y+ V + I K RN N+++ Q+ Sbjct: 158 YTYFLCVIVCIFRGKYRNINLLLTEQL 184 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 21.8 bits (44), Expect = 8.6 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +3 Query: 378 GKLDALIQFWVIFGYSCSENKTREFFVLLYLIQFIN 485 G LD+LI V+ KT+E+ L Q+I+ Sbjct: 81 GSLDSLILLMVLVSIILGSLKTKEWAKLNNKFQYID 116 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 253,059 Number of Sequences: 336 Number of extensions: 6027 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 28547508 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -