BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1456 (1001 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 44 3e-04 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 42 8e-04 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 40 0.002 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_20114| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 40 0.004 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 40 0.004 SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 39 0.006 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 39 0.006 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 39 0.006 SB_11000| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_9177| Best HMM Match : PPI_Ypi1 (HMM E-Value=1.9) 39 0.006 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 39 0.006 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 39 0.007 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 39 0.007 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 39 0.007 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_36181| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 39 0.007 SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 39 0.007 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 39 0.007 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 39 0.007 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 39 0.007 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 38 0.010 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 38 0.010 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 38 0.010 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 38 0.010 SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 38 0.010 SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 38 0.010 SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 38 0.010 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 38 0.010 SB_17566| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 38 0.010 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 38 0.013 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 38 0.013 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 38 0.013 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 38 0.013 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_39977| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_34686| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_34430| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_19538| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_16339| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_15013| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_13185| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 38 0.013 SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 38 0.013 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_897| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 38 0.017 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 38 0.017 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 38 0.017 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 38 0.017 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 38 0.017 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 38 0.017 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 38 0.017 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 38 0.017 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 38 0.017 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 38 0.017 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 38 0.017 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 38 0.017 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 38 0.017 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 38 0.017 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 38 0.017 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 38 0.017 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 38 0.017 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 38 0.017 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 38 0.017 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 38 0.017 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 38 0.017 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 38 0.017 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 38 0.017 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 38 0.017 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 38 0.017 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 38 0.017 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_51470| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 >SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/46 (47%), Positives = 30/46 (65%), Gaps = 3/46 (6%) Frame = -1 Query: 131 GERRSPLSVNNAILTKEH*PRI---SPLVPNSCSPGDPLVLERRPP 3 G ++ L N+ ++T+ H R+ S + NSCSPGDPLVLER PP Sbjct: 35 GRTKTELFENDDVITQVHSSRLRHGSNFLSNSCSPGDPLVLERPPP 80 >SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) Length = 210 Score = 43.6 bits (98), Expect = 3e-04 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -1 Query: 74 PRISPLVPNSCSPGDPLVLERRPP 3 P+ PL NSCSPGDPLVLER PP Sbjct: 80 PKSEPLSSNSCSPGDPLVLERPPP 103 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 62 PLVPNSCSPGDPLVLERRPP 3 PLV NSCSPGDPLVLER PP Sbjct: 2 PLVSNSCSPGDPLVLERPPP 21 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -1 Query: 71 RISPLVPNSCSPGDPLVLERRPP 3 RI P V NSCSPGDPLVLER PP Sbjct: 5 RIPPGVSNSCSPGDPLVLERPPP 27 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/33 (60%), Positives = 24/33 (72%) Frame = -1 Query: 101 NAILTKEH*PRISPLVPNSCSPGDPLVLERRPP 3 NA + K H ++ +V NSCSPGDPLVLER PP Sbjct: 64 NAQVQKHH-RGVNTIVSNSCSPGDPLVLERPPP 95 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 42.7 bits (96), Expect = 4e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 62 PLVPNSCSPGDPLVLERRPP 3 PL+ NSCSPGDPLVLER PP Sbjct: 23 PLISNSCSPGDPLVLERPPP 42 >SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 42.7 bits (96), Expect = 4e-04 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -1 Query: 68 ISPLVPNSCSPGDPLVLERRPP 3 +SP + NSCSPGDPLVLER PP Sbjct: 6 VSPEISNSCSPGDPLVLERPPP 27 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 42.3 bits (95), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 62 PLVPNSCSPGDPLVLERRPP 3 P+V NSCSPGDPLVLER PP Sbjct: 10 PMVSNSCSPGDPLVLERPPP 29 >SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 42.3 bits (95), Expect = 6e-04 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -1 Query: 68 ISPLVPNSCSPGDPLVLERRPP 3 I P+ NSCSPGDPLVLER PP Sbjct: 13 IGPITSNSCSPGDPLVLERPPP 34 >SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 41.9 bits (94), Expect = 8e-04 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -1 Query: 68 ISPLVPNSCSPGDPLVLERRPP 3 I P++ NSCSPGDPLVLER PP Sbjct: 12 IRPVLSNSCSPGDPLVLERPPP 33 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 41.9 bits (94), Expect = 8e-04 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = -1 Query: 68 ISPLVPNSCSPGDPLVLERRPP 3 + P++ NSCSPGDPLVLER PP Sbjct: 52 LEPILSNSCSPGDPLVLERPPP 73 >SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 41.9 bits (94), Expect = 8e-04 Identities = 20/44 (45%), Positives = 25/44 (56%) Frame = -1 Query: 134 WGERRSPLSVNNAILTKEH*PRISPLVPNSCSPGDPLVLERRPP 3 WG++ + + N T + L NSCSPGDPLVLER PP Sbjct: 9 WGKKSNTCNKNTTFSTLKTKNAPLKLSSNSCSPGDPLVLERPPP 52 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 41.9 bits (94), Expect = 8e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 62 PLVPNSCSPGDPLVLERRPP 3 PL+ NSCSPGDPLVLER PP Sbjct: 53 PLLSNSCSPGDPLVLERPPP 72 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 41.9 bits (94), Expect = 8e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 65 SPLVPNSCSPGDPLVLERRPP 3 +PL NSCSPGDPLVLER PP Sbjct: 18 APLASNSCSPGDPLVLERPPP 38 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 41.9 bits (94), Expect = 8e-04 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = -1 Query: 65 SPLVPNSCSPGDPLVLERRPP 3 +P++ NSCSPGDPLVLER PP Sbjct: 15 APVISNSCSPGDPLVLERPPP 35 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 41.9 bits (94), Expect = 8e-04 Identities = 19/21 (90%), Positives = 19/21 (90%), Gaps = 1/21 (4%) Frame = -1 Query: 62 PLVP-NSCSPGDPLVLERRPP 3 PLVP NSCSPGDPLVLER PP Sbjct: 26 PLVPSNSCSPGDPLVLERPPP 46 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -1 Query: 68 ISPLVPNSCSPGDPLVLERRPP 3 IS L+ NSCSPGDPLVLER PP Sbjct: 14 ISFLISNSCSPGDPLVLERPPP 35 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -1 Query: 71 RISPLVPNSCSPGDPLVLERRPP 3 RI+ ++ NSCSPGDPLVLER PP Sbjct: 8 RITKVLSNSCSPGDPLVLERPPP 30 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 62 PLVPNSCSPGDPLVLERRPP 3 PL NSCSPGDPLVLER PP Sbjct: 6 PLASNSCSPGDPLVLERPPP 25 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 41.1 bits (92), Expect = 0.001 Identities = 28/79 (35%), Positives = 41/79 (51%), Gaps = 10/79 (12%) Frame = -1 Query: 209 DRASAPKGGRAALPAAPEIIQNQTRWGERR--SPLSVNNAILTKEH*PR--------ISP 60 DR A GG+ + P PE+ + E + +P S +++ + + R I Sbjct: 33 DRLDASGGGKIS-PVLPELSMKSSNLAENQVLNPSSRDDSTIIPTYRGRQDEKKHVVIEW 91 Query: 59 LVPNSCSPGDPLVLERRPP 3 ++ NSCSPGDPLVLER PP Sbjct: 92 VLSNSCSPGDPLVLERPPP 110 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/23 (78%), Positives = 18/23 (78%) Frame = -1 Query: 71 RISPLVPNSCSPGDPLVLERRPP 3 R P V NSCSPGDPLVLER PP Sbjct: 54 RTIPPVSNSCSPGDPLVLERPPP 76 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -1 Query: 71 RISPLVPNSCSPGDPLVLERRPP 3 +I+ V NSCSPGDPLVLER PP Sbjct: 12 KIADFVSNSCSPGDPLVLERPPP 34 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -1 Query: 68 ISPLVPNSCSPGDPLVLERRPP 3 + P NSCSPGDPLVLER PP Sbjct: 1189 LKPFASNSCSPGDPLVLERPPP 1210 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/39 (51%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = -1 Query: 116 PLSVNNAILTK-EH*PRISPLVPNSCSPGDPLVLERRPP 3 P + + +L + EH S + NSCSPGDPLVLER PP Sbjct: 11 PYNYKHVLLDRHEHVTICSYRISNSCSPGDPLVLERPPP 49 >SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 62 PLVPNSCSPGDPLVLERRPP 3 P + NSCSPGDPLVLER PP Sbjct: 43 PTISNSCSPGDPLVLERPPP 62 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 LV NSCSPGDPLVLER PP Sbjct: 24 LVSNSCSPGDPLVLERPPP 42 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/53 (41%), Positives = 32/53 (60%) Frame = -1 Query: 161 PEIIQNQTRWGERRSPLSVNNAILTKEH*PRISPLVPNSCSPGDPLVLERRPP 3 P +I+N+ +R+S +++ + H P + NSCSPGDPLVLER PP Sbjct: 451 PALIENRI---DRKSQDALDRRRYIQAH-PILEAGASNSCSPGDPLVLERPPP 499 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 LV NSCSPGDPLVLER PP Sbjct: 17 LVSNSCSPGDPLVLERPPP 35 >SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 62 PLVPNSCSPGDPLVLERRPP 3 P+ NSCSPGDPLVLER PP Sbjct: 9 PVTSNSCSPGDPLVLERPPP 28 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 LV NSCSPGDPLVLER PP Sbjct: 9 LVSNSCSPGDPLVLERPPP 27 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -1 Query: 71 RISPLVPNSCSPGDPLVLERRPP 3 R+S L+ NSCSPGDPLVLER PP Sbjct: 30 RVS-LISNSCSPGDPLVLERPPP 51 >SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/22 (77%), Positives = 20/22 (90%), Gaps = 1/22 (4%) Frame = -1 Query: 65 SPLVP-NSCSPGDPLVLERRPP 3 +P++P NSCSPGDPLVLER PP Sbjct: 62 TPILPSNSCSPGDPLVLERPPP 83 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 LV NSCSPGDPLVLER PP Sbjct: 5 LVSNSCSPGDPLVLERPPP 23 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 LV NSCSPGDPLVLER PP Sbjct: 2 LVSNSCSPGDPLVLERPPP 20 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -1 Query: 65 SPLVPNSCSPGDPLVLERRPP 3 SP NSCSPGDPLVLER PP Sbjct: 13 SPFRSNSCSPGDPLVLERPPP 33 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 LV NSCSPGDPLVLER PP Sbjct: 26 LVSNSCSPGDPLVLERPPP 44 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 LV NSCSPGDPLVLER PP Sbjct: 26 LVSNSCSPGDPLVLERPPP 44 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -1 Query: 68 ISPLVPNSCSPGDPLVLERRPP 3 I +V NSCSPGDPLVLER PP Sbjct: 24 IQKVVSNSCSPGDPLVLERPPP 45 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L+ NSCSPGDPLVLER PP Sbjct: 33 LISNSCSPGDPLVLERPPP 51 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L+ NSCSPGDPLVLER PP Sbjct: 37 LISNSCSPGDPLVLERPPP 55 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = -1 Query: 68 ISPLVPNSCSPGDPLVLERRPP 3 ++ +V NSCSPGDPLVLER PP Sbjct: 3471 VARVVSNSCSPGDPLVLERPPP 3492 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L+ NSCSPGDPLVLER PP Sbjct: 8 LISNSCSPGDPLVLERPPP 26 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L+ NSCSPGDPLVLER PP Sbjct: 33 LISNSCSPGDPLVLERPPP 51 >SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -1 Query: 74 PRISPLVPNSCSPGDPLVLERRPP 3 P +SP NSCSPGDPLVLER PP Sbjct: 51 PHLSP--SNSCSPGDPLVLERPPP 72 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L+ NSCSPGDPLVLER PP Sbjct: 33 LISNSCSPGDPLVLERPPP 51 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -1 Query: 71 RISPLVPNSCSPGDPLVLERRPP 3 R + L+ NSCSPGDPLVLER PP Sbjct: 2 RTAILLSNSCSPGDPLVLERPPP 24 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L+ NSCSPGDPLVLER PP Sbjct: 33 LISNSCSPGDPLVLERPPP 51 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L+ NSCSPGDPLVLER PP Sbjct: 33 LISNSCSPGDPLVLERPPP 51 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L+ NSCSPGDPLVLER PP Sbjct: 40 LISNSCSPGDPLVLERPPP 58 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L+ NSCSPGDPLVLER PP Sbjct: 33 LISNSCSPGDPLVLERPPP 51 >SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 62 PLVPNSCSPGDPLVLERRPP 3 P + NSCSPGDPLVLER PP Sbjct: 35 PALSNSCSPGDPLVLERPPP 54 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L+ NSCSPGDPLVLER PP Sbjct: 70 LISNSCSPGDPLVLERPPP 88 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L+ NSCSPGDPLVLER PP Sbjct: 34 LISNSCSPGDPLVLERPPP 52 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -1 Query: 71 RISPLVPNSCSPGDPLVLERRPP 3 R++ V NSCSPGDPLVLER PP Sbjct: 9 RVTLEVSNSCSPGDPLVLERPPP 31 >SB_20114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -1 Query: 71 RISPLVPNSCSPGDPLVLERRPP 3 ++ P NSCSPGDPLVLER PP Sbjct: 15 KVLPAPSNSCSPGDPLVLERPPP 37 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L+ NSCSPGDPLVLER PP Sbjct: 21 LISNSCSPGDPLVLERPPP 39 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L+ NSCSPGDPLVLER PP Sbjct: 16 LISNSCSPGDPLVLERPPP 34 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L+ NSCSPGDPLVLER PP Sbjct: 33 LISNSCSPGDPLVLERPPP 51 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L+ NSCSPGDPLVLER PP Sbjct: 31 LISNSCSPGDPLVLERPPP 49 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 +V NSCSPGDPLVLER PP Sbjct: 347 IVSNSCSPGDPLVLERPPP 365 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -1 Query: 68 ISPLVPNSCSPGDPLVLERRPP 3 + P + NSCSPGDPLVLER PP Sbjct: 158 LPPHLSNSCSPGDPLVLERPPP 179 >SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -1 Query: 68 ISPLVPNSCSPGDPLVLERRPP 3 IS + NSCSPGDPLVLER PP Sbjct: 38 ISFFLSNSCSPGDPLVLERSPP 59 >SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 39.5 bits (88), Expect = 0.004 Identities = 22/37 (59%), Positives = 24/37 (64%), Gaps = 6/37 (16%) Frame = -1 Query: 95 ILTKEH*PR----ISPLVP--NSCSPGDPLVLERRPP 3 I+ EH P I+P P NSCSPGDPLVLER PP Sbjct: 21 IVLSEHLPNSKTDINPRKPPSNSCSPGDPLVLERPPP 57 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 +V NSCSPGDPLVLER PP Sbjct: 1 MVSNSCSPGDPLVLERPPP 19 >SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -1 Query: 68 ISPLVPNSCSPGDPLVLERRPP 3 + P NSCSPGDPLVLER PP Sbjct: 41 VDPARSNSCSPGDPLVLERPPP 62 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 +V NSCSPGDPLVLER PP Sbjct: 85 IVSNSCSPGDPLVLERPPP 103 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 +V NSCSPGDPLVLER PP Sbjct: 13 IVSNSCSPGDPLVLERPPP 31 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 +V NSCSPGDPLVLER PP Sbjct: 6 IVSNSCSPGDPLVLERPPP 24 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 +V NSCSPGDPLVLER PP Sbjct: 1 MVSNSCSPGDPLVLERPPP 19 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -1 Query: 65 SPLVPNSCSPGDPLVLERRPP 3 S ++ NSCSPGDPLVLER PP Sbjct: 24 SLIISNSCSPGDPLVLERPPP 44 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -1 Query: 65 SPLVPNSCSPGDPLVLERRPP 3 S L NSCSPGDPLVLER PP Sbjct: 9 SGLTSNSCSPGDPLVLERPPP 29 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -1 Query: 65 SPLVPNSCSPGDPLVLERRPP 3 S V NSCSPGDPLVLER PP Sbjct: 4 SDRVSNSCSPGDPLVLERPPP 24 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 39.1 bits (87), Expect = 0.006 Identities = 15/22 (68%), Positives = 18/22 (81%) Frame = -1 Query: 68 ISPLVPNSCSPGDPLVLERRPP 3 ++ + NSCSPGDPLVLER PP Sbjct: 257 VTEYISNSCSPGDPLVLERPPP 278 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 39.1 bits (87), Expect = 0.006 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 ++ NSCSPGDPLVLER PP Sbjct: 17 IISNSCSPGDPLVLERPPP 35 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -1 Query: 71 RISPLVPNSCSPGDPLVLERRPP 3 R + V NSCSPGDPLVLER PP Sbjct: 10 RSASQVSNSCSPGDPLVLERPPP 32 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 39.1 bits (87), Expect = 0.006 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L+ NSCSPGDPLVLER PP Sbjct: 62 LLSNSCSPGDPLVLERPPP 80 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 39.1 bits (87), Expect = 0.006 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 ++ NSCSPGDPLVLER PP Sbjct: 119 IISNSCSPGDPLVLERPPP 137 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 1/22 (4%) Frame = -1 Query: 65 SPL-VPNSCSPGDPLVLERRPP 3 SP+ + NSCSPGDPLVLER PP Sbjct: 5 SPITISNSCSPGDPLVLERPPP 26 >SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = -1 Query: 74 PRISPLVPNSCSPGDPLVLERRPP 3 P I NSCSPGDPLVLER PP Sbjct: 16 PTIQARKSNSCSPGDPLVLERPPP 39 >SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 39.1 bits (87), Expect = 0.006 Identities = 18/29 (62%), Positives = 19/29 (65%) Frame = -1 Query: 89 TKEH*PRISPLVPNSCSPGDPLVLERRPP 3 TK R+ NSCSPGDPLVLER PP Sbjct: 52 TKRKDKRLGHARSNSCSPGDPLVLERPPP 80 >SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 39.1 bits (87), Expect = 0.006 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -1 Query: 62 PLVPNSCSPGDPLVLERRPP 3 P NSCSPGDPLVLER PP Sbjct: 4 PFSSNSCSPGDPLVLERPPP 23 >SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 39.1 bits (87), Expect = 0.006 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -1 Query: 62 PLVPNSCSPGDPLVLERRPP 3 P NSCSPGDPLVLER PP Sbjct: 8 PRASNSCSPGDPLVLERPPP 27 >SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 39.1 bits (87), Expect = 0.006 Identities = 21/40 (52%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = -1 Query: 116 PLSVNNAILTKEH*PRISPLV--PNSCSPGDPLVLERRPP 3 P + I T + P + LV NSCSPGDPLVLER PP Sbjct: 165 PRHTDLVIQTSSYRPCYTDLVIQSNSCSPGDPLVLERPPP 204 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 39.1 bits (87), Expect = 0.006 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 ++ NSCSPGDPLVLER PP Sbjct: 14 IISNSCSPGDPLVLERPPP 32 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 39.1 bits (87), Expect = 0.006 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 ++ NSCSPGDPLVLER PP Sbjct: 13 IISNSCSPGDPLVLERPPP 31 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 39.1 bits (87), Expect = 0.006 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 +V NSCSPGDPLVLER PP Sbjct: 7 VVSNSCSPGDPLVLERPPP 25 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 39.1 bits (87), Expect = 0.006 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L+ NSCSPGDPLVLER PP Sbjct: 2 LLSNSCSPGDPLVLERPPP 20 >SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 39.1 bits (87), Expect = 0.006 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -1 Query: 65 SPLVPNSCSPGDPLVLERRPP 3 +P NSCSPGDPLVLER PP Sbjct: 22 TPFGSNSCSPGDPLVLERPPP 42 >SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -1 Query: 71 RISPLVPNSCSPGDPLVLERRPP 3 R L NSCSPGDPLVLER PP Sbjct: 62 RFPKLSSNSCSPGDPLVLERPPP 84 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 39.1 bits (87), Expect = 0.006 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -1 Query: 65 SPLVPNSCSPGDPLVLERRPP 3 S + NSCSPGDPLVLER PP Sbjct: 2419 SAIASNSCSPGDPLVLERPPP 2439 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 39.1 bits (87), Expect = 0.006 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 +V NSCSPGDPLVLER PP Sbjct: 19 VVSNSCSPGDPLVLERPPP 37 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 39.1 bits (87), Expect = 0.006 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 ++ NSCSPGDPLVLER PP Sbjct: 5 IISNSCSPGDPLVLERPPP 23 >SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 39.1 bits (87), Expect = 0.006 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -1 Query: 65 SPLVPNSCSPGDPLVLERRPP 3 S + NSCSPGDPLVLER PP Sbjct: 44 STITSNSCSPGDPLVLERPPP 64 >SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 39.1 bits (87), Expect = 0.006 Identities = 19/32 (59%), Positives = 20/32 (62%) Frame = -1 Query: 98 AILTKEH*PRISPLVPNSCSPGDPLVLERRPP 3 A+LT R NSCSPGDPLVLER PP Sbjct: 10 AVLTPAPVERQHVAASNSCSPGDPLVLERPPP 41 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 39.1 bits (87), Expect = 0.006 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 ++ NSCSPGDPLVLER PP Sbjct: 1 MISNSCSPGDPLVLERPPP 19 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = -1 Query: 74 PRISPLVPNSCSPGDPLVLERRPP 3 P L NSCSPGDPLVLER PP Sbjct: 6 PYFIMLASNSCSPGDPLVLERPPP 29 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 39.1 bits (87), Expect = 0.006 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L+ NSCSPGDPLVLER PP Sbjct: 1 LLSNSCSPGDPLVLERPPP 19 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 39.1 bits (87), Expect = 0.006 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 ++ NSCSPGDPLVLER PP Sbjct: 4 IISNSCSPGDPLVLERPPP 22 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -1 Query: 74 PRISPLVPNSCSPGDPLVLERRPP 3 P+ V NSCSPGDPLVLER PP Sbjct: 17 PKRVNAVSNSCSPGDPLVLERPPP 40 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 39.1 bits (87), Expect = 0.006 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L+ NSCSPGDPLVLER PP Sbjct: 7 LLSNSCSPGDPLVLERPPP 25 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 39.1 bits (87), Expect = 0.006 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -1 Query: 68 ISPLVPNSCSPGDPLVLERRPP 3 + L NSCSPGDPLVLER PP Sbjct: 12 LKSLTSNSCSPGDPLVLERPPP 33 >SB_11000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 39.1 bits (87), Expect = 0.006 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -1 Query: 62 PLVPNSCSPGDPLVLERRPP 3 P NSCSPGDPLVLER PP Sbjct: 5 PQASNSCSPGDPLVLERPPP 24 >SB_9177| Best HMM Match : PPI_Ypi1 (HMM E-Value=1.9) Length = 121 Score = 39.1 bits (87), Expect = 0.006 Identities = 19/36 (52%), Positives = 23/36 (63%) Frame = -1 Query: 110 SVNNAILTKEH*PRISPLVPNSCSPGDPLVLERRPP 3 SV +A+ P + + NSCSPGDPLVLER PP Sbjct: 77 SVIDAMRKSIEPPSATGISSNSCSPGDPLVLERPPP 112 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 39.1 bits (87), Expect = 0.006 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -1 Query: 68 ISPLVPNSCSPGDPLVLERRPP 3 ++ V NSCSPGDPLVLER PP Sbjct: 189 VAVAVSNSCSPGDPLVLERPPP 210 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 39.1 bits (87), Expect = 0.006 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 ++ NSCSPGDPLVLER PP Sbjct: 13 IISNSCSPGDPLVLERPPP 31 >SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1295 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = -1 Query: 74 PRISPLVPNSCSPGDPLVLERRPP 3 PR+ + NSCSPGDPLVLER PP Sbjct: 587 PRVG--ISNSCSPGDPLVLERPPP 608 >SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -1 Query: 68 ISPLVPNSCSPGDPLVLERRPP 3 I P NSCSPGDPLVLER PP Sbjct: 10 IIPKPSNSCSPGDPLVLERPPP 31 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 30 VSNSCSPGDPLVLERPPP 47 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -1 Query: 68 ISPLVPNSCSPGDPLVLERRPP 3 +S NSCSPGDPLVLER PP Sbjct: 77 LSRFTSNSCSPGDPLVLERPPP 98 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 10 VSNSCSPGDPLVLERPPP 27 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 38.7 bits (86), Expect = 0.007 Identities = 18/21 (85%), Positives = 18/21 (85%), Gaps = 1/21 (4%) Frame = -1 Query: 62 PLVP-NSCSPGDPLVLERRPP 3 PLV NSCSPGDPLVLER PP Sbjct: 889 PLVTSNSCSPGDPLVLERPPP 909 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 2 VSNSCSPGDPLVLERPPP 19 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L NSCSPGDPLVLER PP Sbjct: 15 LTSNSCSPGDPLVLERPPP 33 >SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/25 (68%), Positives = 20/25 (80%), Gaps = 1/25 (4%) Frame = -1 Query: 74 PRISPLVP-NSCSPGDPLVLERRPP 3 P++ L+ NSCSPGDPLVLER PP Sbjct: 14 PKLKLLITSNSCSPGDPLVLERPPP 38 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 40 VSNSCSPGDPLVLERPPP 57 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 117 VSNSCSPGDPLVLERPPP 134 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 184 VSNSCSPGDPLVLERPPP 201 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 34 VSNSCSPGDPLVLERPPP 51 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 1066 VSNSCSPGDPLVLERPPP 1083 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 ++ NSCSPGDPLVLER PP Sbjct: 14 VISNSCSPGDPLVLERPPP 32 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L NSCSPGDPLVLER PP Sbjct: 78 LTSNSCSPGDPLVLERPPP 96 >SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) Length = 190 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -1 Query: 71 RISPLVPNSCSPGDPLVLERRPP 3 R S NSCSPGDPLVLER PP Sbjct: 61 RKSSTTSNSCSPGDPLVLERPPP 83 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 3 VSNSCSPGDPLVLERPPP 20 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 214 VSNSCSPGDPLVLERPPP 231 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 32 VSNSCSPGDPLVLERPPP 49 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L NSCSPGDPLVLER PP Sbjct: 5 LASNSCSPGDPLVLERPPP 23 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 5 VSNSCSPGDPLVLERPPP 22 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 3 VSNSCSPGDPLVLERPPP 20 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 7 VSNSCSPGDPLVLERPPP 24 >SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -1 Query: 68 ISPLVPNSCSPGDPLVLERRPP 3 I + NSCSPGDPLVLER PP Sbjct: 25 IPKIASNSCSPGDPLVLERPPP 46 >SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -1 Query: 74 PRISPLVPNSCSPGDPLVLERRPP 3 P+ + NSCSPGDPLVLER PP Sbjct: 6 PKHKKSLSNSCSPGDPLVLERPPP 29 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 64 VSNSCSPGDPLVLERPPP 81 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 4 VSNSCSPGDPLVLERPPP 21 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L NSCSPGDPLVLER PP Sbjct: 6 LASNSCSPGDPLVLERPPP 24 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 19 VSNSCSPGDPLVLERPPP 36 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 4 VSNSCSPGDPLVLERPPP 21 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 11 VSNSCSPGDPLVLERPPP 28 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 25 VSNSCSPGDPLVLERPPP 42 >SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -1 Query: 62 PLVPNSCSPGDPLVLERRPP 3 P NSCSPGDPLVLER PP Sbjct: 24 PNTSNSCSPGDPLVLERPPP 43 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 15 VSNSCSPGDPLVLERPPP 32 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L NSCSPGDPLVLER PP Sbjct: 17 LASNSCSPGDPLVLERPPP 35 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 31 VSNSCSPGDPLVLERPPP 48 >SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.7 bits (86), Expect = 0.007 Identities = 18/23 (78%), Positives = 19/23 (82%), Gaps = 1/23 (4%) Frame = -1 Query: 68 ISPLVP-NSCSPGDPLVLERRPP 3 IS +P NSCSPGDPLVLER PP Sbjct: 9 ISANIPSNSCSPGDPLVLERPPP 31 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 4 VSNSCSPGDPLVLERPPP 21 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 41 VSNSCSPGDPLVLERPPP 58 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 15 VSNSCSPGDPLVLERPPP 32 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 4 VSNSCSPGDPLVLERPPP 21 >SB_36181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 5 ISNSCSPGDPLVLERTPP 22 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 14 VSNSCSPGDPLVLERPPP 31 >SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 38.7 bits (86), Expect = 0.007 Identities = 18/27 (66%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = -1 Query: 80 H*PRISPLVP-NSCSPGDPLVLERRPP 3 H P + P NSCSPGDPLVLER PP Sbjct: 10 HNPEVRGSKPSNSCSPGDPLVLERPPP 36 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 6 VSNSCSPGDPLVLERPPP 23 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 ++ NSCSPGDPLVLER PP Sbjct: 5 VISNSCSPGDPLVLERPPP 23 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 15 VSNSCSPGDPLVLERPPP 32 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L NSCSPGDPLVLER PP Sbjct: 37 LTSNSCSPGDPLVLERPPP 55 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 18 VSNSCSPGDPLVLERPPP 35 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L NSCSPGDPLVLER PP Sbjct: 11 LTSNSCSPGDPLVLERPPP 29 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 30 VSNSCSPGDPLVLERPPP 47 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 32 VSNSCSPGDPLVLERPPP 49 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 10 VSNSCSPGDPLVLERPPP 27 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 17 VSNSCSPGDPLVLERPPP 34 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 34 VSNSCSPGDPLVLERPPP 51 >SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -1 Query: 62 PLVPNSCSPGDPLVLERRPP 3 P NSCSPGDPLVLER PP Sbjct: 62 PETSNSCSPGDPLVLERPPP 81 >SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) Length = 134 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/22 (68%), Positives = 18/22 (81%) Frame = -1 Query: 68 ISPLVPNSCSPGDPLVLERRPP 3 ++ + NSCSPGDPLVLER PP Sbjct: 6 LAQITSNSCSPGDPLVLERPPP 27 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L NSCSPGDPLVLER PP Sbjct: 88 LTSNSCSPGDPLVLERPPP 106 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 8 VSNSCSPGDPLVLERPPP 25 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 10 VSNSCSPGDPLVLERPPP 27 >SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -1 Query: 62 PLVPNSCSPGDPLVLERRPP 3 P NSCSPGDPLVLER PP Sbjct: 52 PFRSNSCSPGDPLVLERPPP 71 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 18 VSNSCSPGDPLVLERPPP 35 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L NSCSPGDPLVLER PP Sbjct: 11 LASNSCSPGDPLVLERPPP 29 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L NSCSPGDPLVLER PP Sbjct: 3 LASNSCSPGDPLVLERPPP 21 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L NSCSPGDPLVLER PP Sbjct: 661 LASNSCSPGDPLVLERPPP 679 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 27 VSNSCSPGDPLVLERPPP 44 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 9 VSNSCSPGDPLVLERPPP 26 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 ++ NSCSPGDPLVLER PP Sbjct: 25 VISNSCSPGDPLVLERPPP 43 >SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -1 Query: 74 PRISPLVPNSCSPGDPLVLERRPP 3 P+ + NSCSPGDPLVLER PP Sbjct: 29 PKQESIRSNSCSPGDPLVLERPPP 52 >SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.7 bits (86), Expect = 0.007 Identities = 18/23 (78%), Positives = 19/23 (82%), Gaps = 1/23 (4%) Frame = -1 Query: 68 ISPLVP-NSCSPGDPLVLERRPP 3 IS +P NSCSPGDPLVLER PP Sbjct: 9 ISANIPSNSCSPGDPLVLERPPP 31 >SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) Length = 270 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -1 Query: 68 ISPLVPNSCSPGDPLVLERRPP 3 I+ + NSCSPGDPLVLER PP Sbjct: 142 INLITSNSCSPGDPLVLERPPP 163 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L NSCSPGDPLVLER PP Sbjct: 96 LASNSCSPGDPLVLERPPP 114 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L NSCSPGDPLVLER PP Sbjct: 4 LASNSCSPGDPLVLERPPP 22 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 V NSCSPGDPLVLER PP Sbjct: 10 VSNSCSPGDPLVLERPPP 27 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 38.3 bits (85), Expect = 0.010 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -1 Query: 62 PLVPNSCSPGDPLVLERRPP 3 P NSCSPGDPLVLER PP Sbjct: 24 PRPSNSCSPGDPLVLERPPP 43 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 5 ISNSCSPGDPLVLERPPP 22 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 101 ISNSCSPGDPLVLERPPP 118 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 38.3 bits (85), Expect = 0.010 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -1 Query: 71 RISPLVPNSCSPGDPLVLERRPP 3 R S NSCSPGDPLVLER PP Sbjct: 18 RRSKRASNSCSPGDPLVLERPPP 40 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 16 ISNSCSPGDPLVLERPPP 33 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 38.3 bits (85), Expect = 0.010 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -1 Query: 68 ISPLVPNSCSPGDPLVLERRPP 3 + PL NSCSPGDPLVLER PP Sbjct: 61 VQPL-SNSCSPGDPLVLERPPP 81 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 ++ NSCSPGDPLVLER PP Sbjct: 13 ILSNSCSPGDPLVLERPPP 31 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 38.3 bits (85), Expect = 0.010 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -1 Query: 71 RISPLVPNSCSPGDPLVLERRPP 3 R S NSCSPGDPLVLER PP Sbjct: 15 RGSQTASNSCSPGDPLVLERPPP 37 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 38.3 bits (85), Expect = 0.010 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -1 Query: 68 ISPLVPNSCSPGDPLVLERRPP 3 I+ NSCSPGDPLVLER PP Sbjct: 10 INSTASNSCSPGDPLVLERPPP 31 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 21 ISNSCSPGDPLVLERPPP 38 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 59 ISNSCSPGDPLVLERPPP 76 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 10 ISNSCSPGDPLVLERPPP 27 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 3 ISNSCSPGDPLVLERPPP 20 >SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 13 ISNSCSPGDPLVLERPPP 30 >SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 4 ISNSCSPGDPLVLERPPP 21 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 52 ISNSCSPGDPLVLERPPP 69 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 51 ISNSCSPGDPLVLERPPP 68 >SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) Length = 128 Score = 38.3 bits (85), Expect = 0.010 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -1 Query: 68 ISPLVPNSCSPGDPLVLERRPP 3 ++ L NSCSPGDPLVLER PP Sbjct: 1 MTSLSSNSCSPGDPLVLERPPP 22 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 16 ISNSCSPGDPLVLERPPP 33 >SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 38.3 bits (85), Expect = 0.010 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -1 Query: 74 PRISPLVPNSCSPGDPLVLERRPP 3 P + + NSCSPGDPLVLER PP Sbjct: 5 PDVISELSNSCSPGDPLVLERPPP 28 >SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 21 ISNSCSPGDPLVLERPPP 38 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 152 ISNSCSPGDPLVLERPPP 169 >SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 4 ISNSCSPGDPLVLERPPP 21 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 47 ISNSCSPGDPLVLERPPP 64 >SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 7 ISNSCSPGDPLVLERPPP 24 >SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 38.3 bits (85), Expect = 0.010 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -1 Query: 71 RISPLVPNSCSPGDPLVLERRPP 3 ++S NSCSPGDPLVLER PP Sbjct: 2 KLSYRTSNSCSPGDPLVLERPPP 24 >SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 4 ISNSCSPGDPLVLERPPP 21 >SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 38.3 bits (85), Expect = 0.010 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -1 Query: 68 ISPLVPNSCSPGDPLVLERRPP 3 I + NSCSPGDPLVLER PP Sbjct: 22 IMRITSNSCSPGDPLVLERPPP 43 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 32 ISNSCSPGDPLVLERPPP 49 >SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) Length = 213 Score = 38.3 bits (85), Expect = 0.010 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -1 Query: 68 ISPLVPNSCSPGDPLVLERRPP 3 +S NSCSPGDPLVLER PP Sbjct: 113 VSKAESNSCSPGDPLVLERPPP 134 >SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 38.3 bits (85), Expect = 0.010 Identities = 24/53 (45%), Positives = 27/53 (50%) Frame = -1 Query: 161 PEIIQNQTRWGERRSPLSVNNAILTKEH*PRISPLVPNSCSPGDPLVLERRPP 3 PE + N + E S L N I+T NSCSPGDPLVLER PP Sbjct: 37 PETVSNVDKLKETLSKLPNNLFIITTS----------NSCSPGDPLVLERPPP 79 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 18 ISNSCSPGDPLVLERPPP 35 >SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) Length = 1098 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 974 ISNSCSPGDPLVLERPPP 991 >SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 34 ITSNSCSPGDPLVLERSPP 52 >SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 6 ISNSCSPGDPLVLERPPP 23 >SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.3 bits (85), Expect = 0.010 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -1 Query: 62 PLVPNSCSPGDPLVLERRPP 3 P NSCSPGDPLVLER PP Sbjct: 12 PQKSNSCSPGDPLVLERPPP 31 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 ++ NSCSPGDPLVLER PP Sbjct: 65 MLSNSCSPGDPLVLERPPP 83 >SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 38.3 bits (85), Expect = 0.010 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = -1 Query: 71 RISPLVPNSCSPGDPLVLERRPP 3 R + NSCSPGDPLVLER PP Sbjct: 41 RAEAALSNSCSPGDPLVLERPPP 63 >SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 1 ISNSCSPGDPLVLERPPP 18 >SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 5 ISNSCSPGDPLVLERPPP 22 >SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 38.3 bits (85), Expect = 0.010 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -1 Query: 71 RISPLVPNSCSPGDPLVLERRPP 3 R S + NSCSPGDPLVLER PP Sbjct: 8 RESYALSNSCSPGDPLVLERPPP 30 >SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) Length = 126 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 32 ISNSCSPGDPLVLERPPP 49 >SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 116 ISNSCSPGDPLVLERPPP 133 >SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 38.3 bits (85), Expect = 0.010 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -1 Query: 62 PLVPNSCSPGDPLVLERRPP 3 P NSCSPGDPLVLER PP Sbjct: 16 PRESNSCSPGDPLVLERPPP 35 >SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 2 ISNSCSPGDPLVLERPPP 19 >SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 2 ISNSCSPGDPLVLERPPP 19 >SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 14 ISNSCSPGDPLVLERPPP 31 >SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 2 ISNSCSPGDPLVLERPPP 19 >SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 8 ISNSCSPGDPLVLERPPP 25 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 52 ISNSCSPGDPLVLERPPP 69 >SB_17566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 38.3 bits (85), Expect = 0.010 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -1 Query: 62 PLVPNSCSPGDPLVLERRPP 3 P NSCSPGDPLVLER PP Sbjct: 7 PYGSNSCSPGDPLVLERPPP 26 >SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) Length = 802 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 90 ISNSCSPGDPLVLERPPP 107 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 ++ NSCSPGDPLVLER PP Sbjct: 104 ILSNSCSPGDPLVLERPPP 122 >SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 38.3 bits (85), Expect = 0.010 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -1 Query: 68 ISPLVPNSCSPGDPLVLERRPP 3 I+ + NSCSPGDPLVLER PP Sbjct: 13 ITNISSNSCSPGDPLVLERPPP 34 >SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 38.3 bits (85), Expect = 0.010 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -1 Query: 68 ISPLVPNSCSPGDPLVLERRPP 3 +S + NSCSPGDPLVLER PP Sbjct: 15 LSRVSSNSCSPGDPLVLERPPP 36 >SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 7 ISNSCSPGDPLVLERPPP 24 >SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 38.3 bits (85), Expect = 0.010 Identities = 18/25 (72%), Positives = 20/25 (80%), Gaps = 1/25 (4%) Frame = -1 Query: 74 PRISPLVP-NSCSPGDPLVLERRPP 3 P+ L+P NSCSPGDPLVLER PP Sbjct: 16 PKHHFLLPSNSCSPGDPLVLERPPP 40 >SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 ++ NSCSPGDPLVLER PP Sbjct: 12 ILSNSCSPGDPLVLERPPP 30 >SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 6 ISNSCSPGDPLVLERPPP 23 >SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 68 ISNSCSPGDPLVLERPPP 85 >SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 30 ISNSCSPGDPLVLERPPP 47 >SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 46 ISNSCSPGDPLVLERPPP 63 >SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 4 ISNSCSPGDPLVLERPPP 21 >SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 12 ISNSCSPGDPLVLERPPP 29 >SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 56 VPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 10 ISNSCSPGDPLVLERPPP 27 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 37.9 bits (84), Expect = 0.013 Identities = 20/37 (54%), Positives = 23/37 (62%) Frame = -1 Query: 113 LSVNNAILTKEH*PRISPLVPNSCSPGDPLVLERRPP 3 +SV N++ I P NSCSPGDPLVLER PP Sbjct: 166 VSVTNSLTVIAGTTTIPP--SNSCSPGDPLVLERPPP 200 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.9 bits (84), Expect = 0.013 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 13 IASNSCSPGDPLVLERPPP 31 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 37.9 bits (84), Expect = 0.013 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 L NSCSPGDPLVLER PP Sbjct: 25 LPSNSCSPGDPLVLERPPP 43 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 37.9 bits (84), Expect = 0.013 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -1 Query: 68 ISPLVPNSCSPGDPLVLERRPP 3 +S NSCSPGDPLVLER PP Sbjct: 14 VSHNTSNSCSPGDPLVLERPPP 35 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.9 bits (84), Expect = 0.013 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 59 LVPNSCSPGDPLVLERRPP 3 + NSCSPGDPLVLER PP Sbjct: 1 MASNSCSPGDPLVLERPPP 19 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,425,046 Number of Sequences: 59808 Number of extensions: 677160 Number of successful extensions: 3125 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2984 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3124 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2991217451 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -