BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1454 (756 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13109| Best HMM Match : Dynein_heavy (HMM E-Value=2.6e-09) 29 5.4 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 28 7.1 >SB_13109| Best HMM Match : Dynein_heavy (HMM E-Value=2.6e-09) Length = 1703 Score = 28.7 bits (61), Expect = 5.4 Identities = 9/31 (29%), Positives = 20/31 (64%) Frame = -3 Query: 745 LKMFSASVHDTTQNRVSQLLIRYRKDRFLYD 653 + +F S+HD+ ++++ + +RY D F Y+ Sbjct: 1363 VNLFLNSIHDSNKSKILERRLRYLSDHFTYN 1393 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -3 Query: 736 FSASVHDTTQNRVSQLLIRYRKDRFLYDANKF 641 F A + + + R+S+ I YRK L+D N+F Sbjct: 275 FRAELENRFRERISEQSIDYRKPTSLFDINRF 306 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,994,730 Number of Sequences: 59808 Number of extensions: 355645 Number of successful extensions: 571 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 553 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 571 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2058295707 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -