BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1453 (820 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 25 0.72 S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 23 2.2 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 25.0 bits (52), Expect = 0.72 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = +1 Query: 22 LICNGVVNCPNITTSEKKFWTAEEKRAKEAYSEDSLRRLGYLDA 153 ++ N +V P T + WTA +R +A + +GY+ A Sbjct: 576 VVSNRLVESPCCITMRRYGWTANMERIMKAQALRDTSTMGYMAA 619 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 23.4 bits (48), Expect = 2.2 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +1 Query: 82 TAEEKRAKEAYSEDSLRRL 138 TAEEKR + A+S L RL Sbjct: 225 TAEEKRPRTAFSGAQLARL 243 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,253 Number of Sequences: 336 Number of extensions: 4303 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22414104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -