BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1449 (736 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40639| Best HMM Match : CAP_GLY (HMM E-Value=0) 42 7e-04 SB_20015| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 36 0.026 SB_13740| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_28668| Best HMM Match : UCH (HMM E-Value=8e-12) 33 0.24 SB_8802| Best HMM Match : WW (HMM E-Value=3.2e-31) 33 0.24 SB_52413| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.73 SB_17603| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.73 SB_1298| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.97 SB_48138| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.97 SB_20665| Best HMM Match : 7tm_3 (HMM E-Value=1.8e-10) 31 0.97 SB_2996| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.97 SB_44622| Best HMM Match : dsrm (HMM E-Value=3.1e-16) 30 1.7 SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) 30 1.7 SB_32768| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_21992| Best HMM Match : LRR_1 (HMM E-Value=3.2e-07) 29 3.0 SB_10355| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0037) 29 3.9 SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_899| Best HMM Match : Alpha_L_fucos (HMM E-Value=0) 29 3.9 SB_59297| Best HMM Match : zf-DNL (HMM E-Value=0.68) 28 6.8 SB_23179| Best HMM Match : REV (HMM E-Value=4.8) 28 6.8 SB_26933| Best HMM Match : CXC (HMM E-Value=0.0082) 28 9.0 SB_1966| Best HMM Match : GRP (HMM E-Value=0.53) 28 9.0 >SB_40639| Best HMM Match : CAP_GLY (HMM E-Value=0) Length = 709 Score = 41.5 bits (93), Expect = 7e-04 Identities = 17/34 (50%), Positives = 20/34 (58%) Frame = +2 Query: 122 EEILPEGWEARKSRSTGMTYYLNKHTKKSQWEKP 223 E LPEGW KSR G YY N T +S+W+ P Sbjct: 80 EANLPEGWIISKSRQHGRMYYFNTETAESRWQHP 113 >SB_20015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 593 Score = 38.3 bits (85), Expect = 0.006 Identities = 14/31 (45%), Positives = 23/31 (74%) Frame = +2 Query: 131 LPEGWEARKSRSTGMTYYLNKHTKKSQWEKP 223 LP GWE R++ S G TYY++ +T+ + W++P Sbjct: 415 LPHGWE-RRTDSRGRTYYVDHNTRTTTWQRP 444 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +2 Query: 122 EEILPEGWEARKSRSTGMTYYLNKHTKKSQWEKP 223 EE LP GWE R G YY++ +++ + WE+P Sbjct: 380 EEPLPPGWEQRVDPH-GRIYYVDHNSRTTAWERP 412 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 36.3 bits (80), Expect = 0.026 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +2 Query: 119 QEEILPEGWEARKSRSTGMTYYLNKHTKKSQWEKP 223 +E P GW R +Y N TKKSQWE P Sbjct: 415 EESASPPGWSCHWDRKYKQYFYTNLETKKSQWEFP 449 Score = 32.7 bits (71), Expect = 0.32 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = +2 Query: 83 FPAQRTNDMASTQEEILPEG---WEARKSRSTGMTYYLNKHTKKSQWEKPGG 229 F ++ ND +E + + W+A + ++ YY N+ T + QWE P G Sbjct: 92 FQQEQDNDKEHDEEPMEEDPNYPWQACRDEASNCYYYWNQETNEVQWEMPPG 143 >SB_13740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 430 Score = 35.9 bits (79), Expect = 0.034 Identities = 14/43 (32%), Positives = 26/43 (60%) Frame = +2 Query: 110 ASTQEEILPEGWEARKSRSTGMTYYLNKHTKKSQWEKPGGPAS 238 ++ Q LPEGWE R+ + G T+Y++ T+ + W +P ++ Sbjct: 177 SAEQPPPLPEGWEERQD-ANGRTFYIDHTTRTTTWVRPSSEST 218 >SB_28668| Best HMM Match : UCH (HMM E-Value=8e-12) Length = 893 Score = 33.1 bits (72), Expect = 0.24 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +2 Query: 131 LPEGWEARKSRSTGMTYYLNKHTKKSQWEKP 223 LP GWE ++TG +Y + +T+ + W P Sbjct: 489 LPHGWEKAVDQTTGRIFYRDHNTQTTHWNPP 519 >SB_8802| Best HMM Match : WW (HMM E-Value=3.2e-31) Length = 662 Score = 33.1 bits (72), Expect = 0.24 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +2 Query: 143 WEARKSRSTGMTYYLNKHTKKSQWEKP 223 W K+ S G TYY N T++S WEKP Sbjct: 87 WLEHKT-SDGKTYYYNARTRESAWEKP 112 >SB_52413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 838 Score = 31.5 bits (68), Expect = 0.73 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +2 Query: 113 STQEEILPEGWEARKSRSTGMTYYLNKHTKKSQWEKP 223 S+Q+ P+GWE +S G+ YY+N T SQ E P Sbjct: 358 SSQQTESPDGWEQVESPQYGI-YYVNHATGSSQREHP 393 >SB_17603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 826 Score = 31.5 bits (68), Expect = 0.73 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = +2 Query: 119 QEEILPEGWEARKSRSTGMTYYLNKHTKKSQWEKP 223 Q+ LP GWE ++G ++++ +T+ + W P Sbjct: 4 QQHPLPNGWEMTVDPNSGRPFFIDHNTRTTTWTDP 38 >SB_1298| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1668 Score = 31.1 bits (67), Expect = 0.97 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +2 Query: 131 LPEGWEARKSRSTGMTYYLNKHTKKSQWEKP 223 LP GWE + G YY++ ++ ++ W P Sbjct: 11 LPVGWEEARDTRDGRVYYIDHYSHRTTWIDP 41 >SB_48138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1913 Score = 31.1 bits (67), Expect = 0.97 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +2 Query: 116 TQEEILPEGWEARKSRSTGMTYYLNKHTKKSQWEKP 223 + E LP+GW +S TG YY + + +QWE+P Sbjct: 1273 SNEYELPDGWMEVES-GTGSKYYWHVSSGTTQWERP 1307 >SB_20665| Best HMM Match : 7tm_3 (HMM E-Value=1.8e-10) Length = 1514 Score = 31.1 bits (67), Expect = 0.97 Identities = 17/63 (26%), Positives = 31/63 (49%) Frame = +1 Query: 343 REEHITRTKEEALDILQEYRRKIIDREAKFEELASTYSDCSSAKRDGDLGRFKKGQCRNH 522 +EE +T +E+ L ++ +RK++ EAK ++ C + R+ K+G N Sbjct: 1434 QEESVTEDQEQLLAQVERLQRKVVSLEAKLQK-----QQCKNTSRENTSNANKRGSFINV 1488 Query: 523 LKT 531 L T Sbjct: 1489 LAT 1491 >SB_2996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 31.1 bits (67), Expect = 0.97 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 3/61 (4%) Frame = +1 Query: 256 DDDEGGIPKEVRCSHLLVKHSGS---RRPSSWREEHITRTKEEALDILQEYRRKIIDREA 426 + DE G P E + LL + RP+ + EE + + K+E D ++E + K++ R Sbjct: 7 EGDEPGSPDEKLSTDLLNQEYDEPTPERPTKFLEEELAKRKQEKQDRMREEKLKLLQRIT 66 Query: 427 K 429 K Sbjct: 67 K 67 >SB_44622| Best HMM Match : dsrm (HMM E-Value=3.1e-16) Length = 724 Score = 30.3 bits (65), Expect = 1.7 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 131 LPEGWEARKSRSTGMTYYLNKHTKKSQWEKP 223 LP+GW A RS G+ YL++ T+ W +P Sbjct: 52 LPDGWLALNHRSGGI-IYLHRPTRVCTWSRP 81 >SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) Length = 693 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +2 Query: 92 QRTNDMASTQEEILPE-GWEARKSRSTGMTYYLNKHTKKSQWEKP 223 Q+ +++ + E IL W+ K+ S G YY N TK+S W +P Sbjct: 194 QKPDELKTPSEIILDSFPWKEHKADS-GRVYYHNTETKESIWTEP 237 >SB_32768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1393 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +2 Query: 122 EEILPEGWEARKSRSTGMTYYLNKHTKKSQWEKP 223 ++ LP GWE G TYY++ KK+Q+E P Sbjct: 327 DDELPYGWEKVDDPKYG-TYYIDHINKKTQFENP 359 >SB_21992| Best HMM Match : LRR_1 (HMM E-Value=3.2e-07) Length = 534 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +2 Query: 56 LRKRKNLLAFPAQRTNDMASTQEEILPEGWEARKSRST 169 LR++++LLA R +MAST +E L W+ + ST Sbjct: 200 LREKEDLLAEEQYRKEEMASTTDEDLLRIWDEKPVTST 237 >SB_10355| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0037) Length = 1127 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/42 (28%), Positives = 25/42 (59%) Frame = +1 Query: 364 TKEEALDILQEYRRKIIDREAKFEELASTYSDCSSAKRDGDL 489 ++ E LD++QE ++ + +RE + ++L +D S + DL Sbjct: 1046 SRTEDLDLIQELKQMLAERELEMKKLLRNMNDLRSQNKRRDL 1087 >SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2462 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -3 Query: 374 SSLVRVICSSRHEDGRRLPLCFTSKWLHLTSLGI 273 S + R IC H+DG + S W H+ +GI Sbjct: 1258 SGITRCICGYNHDDGYMICCDKCSVWQHIECMGI 1291 >SB_899| Best HMM Match : Alpha_L_fucos (HMM E-Value=0) Length = 1127 Score = 29.1 bits (62), Expect = 3.9 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 1/74 (1%) Frame = +1 Query: 256 DDDEGGIPKEVRCSHLLVKHSGSRRPSSWREEHITRTKEEAL-DILQEYRRKIIDREAKF 432 DDDEGG + H S S++ S ++ H + K+E + + E R+K +A Sbjct: 1051 DDDEGGGDDKFEPKHKKKGRSSSKKRHSRKKGHEEQQKKETIRKEINEKRKKKRQDKADA 1110 Query: 433 EELASTYSDCSSAK 474 + T D +AK Sbjct: 1111 SRIGLTTLDRFTAK 1124 >SB_59297| Best HMM Match : zf-DNL (HMM E-Value=0.68) Length = 629 Score = 28.3 bits (60), Expect = 6.8 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +1 Query: 367 KEEALDILQEYRRKIIDREAK-FEELASTYSDCSSAKRDGDLGRFKK 504 + ++LD+ EYR + D ++K F E+ TY C S K L + K Sbjct: 293 RSKSLDL--EYRYMVSDGDSKAFNEIWDTYGVCDSCKTHHSLDKSSK 337 >SB_23179| Best HMM Match : REV (HMM E-Value=4.8) Length = 125 Score = 28.3 bits (60), Expect = 6.8 Identities = 16/51 (31%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Frame = +1 Query: 310 KHSGSRRPSSWREEHITRTKEEALDILQEYRRKIIDREAK-FEELASTYSD 459 K RR + +EE T+++E+ +++ E +RK++D K E+L + SD Sbjct: 31 KRKNERRKKA-QEELQTKSREKMIEVRAENKRKMLDEMRKQTEQLEALQSD 80 >SB_26933| Best HMM Match : CXC (HMM E-Value=0.0082) Length = 842 Score = 27.9 bits (59), Expect = 9.0 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +1 Query: 373 EALDI-LQEYRRKIIDREAK-FEELASTYSDCSSAKRDGDLGRFKK 504 E DI Q YR + D ++K F E+ TY C S K L + K Sbjct: 506 EIFDIPCQTYRYMVSDADSKAFNEIWDTYGVCDSCKTHHSLDKSSK 551 >SB_1966| Best HMM Match : GRP (HMM E-Value=0.53) Length = 178 Score = 27.9 bits (59), Expect = 9.0 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +1 Query: 256 DDDEGGIPKEVRCSHLLVKHS-GSRRPSSWR 345 DDD+G CS+ L+ HS G RP W+ Sbjct: 85 DDDDGAAIAIASCSNYLIFHSLGFLRPGVWQ 115 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,512,909 Number of Sequences: 59808 Number of extensions: 412181 Number of successful extensions: 1049 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 997 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1048 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1974037988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -