BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1444 (699 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like pr... 23 2.4 AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 22 5.5 AF321227-6|AAK16426.1| 150|Tribolium castaneum Pb protein. 21 9.7 AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia or... 21 9.7 >DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like protein protein. Length = 135 Score = 23.0 bits (47), Expect = 2.4 Identities = 8/21 (38%), Positives = 16/21 (76%) Frame = +2 Query: 275 SYDYLKTLASDVHVVRGDFDE 337 S + +TL SD+++++ +FDE Sbjct: 22 SEETCETLMSDINLIKEEFDE 42 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 21.8 bits (44), Expect = 5.5 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +2 Query: 509 NTRISSISILVQLLEVTALYTGILLLRLC*WTFRVRQWSPTFTSSSVMKSK 661 N +S I ++V+ L +LY + + T + +WS F ++SK Sbjct: 58 NAHLSGIQLVVRNLLDISLYLNAYHVFVTMMTLKRHKWSTLFEILLKLESK 108 >AF321227-6|AAK16426.1| 150|Tribolium castaneum Pb protein. Length = 150 Score = 21.0 bits (42), Expect = 9.7 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -2 Query: 485 ALISGCPHPAA 453 A SG PHPAA Sbjct: 39 AAASGAPHPAA 49 >AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia ortholog protein. Length = 477 Score = 21.0 bits (42), Expect = 9.7 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -2 Query: 485 ALISGCPHPAA 453 A SG PHPAA Sbjct: 39 AAASGAPHPAA 49 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,294 Number of Sequences: 336 Number of extensions: 4052 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -