BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1441 (680 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35719| Best HMM Match : OAD_gamma (HMM E-Value=5.3) 31 0.65 SB_23117| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 >SB_35719| Best HMM Match : OAD_gamma (HMM E-Value=5.3) Length = 262 Score = 31.5 bits (68), Expect = 0.65 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = -1 Query: 680 YTLVFSSYYCNIHIYCITYVYSLVSILCVHCILFIFR*MI 561 Y + ++ YC IHI + Y + ++ C+H +L ++R +I Sbjct: 140 YRRLINAVYC-IHIVLVVYRRLINAVYCIHIVLVVYRRLI 178 >SB_23117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 27.9 bits (59), Expect = 8.0 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = +1 Query: 145 RSSRSRILARLTNSNSFIYSFIYIDFRNSEPRRSKNETNIFFNSGTK 285 R SRSR + ++ +S IY+ + F +S+ ++ +E + SGT+ Sbjct: 59 RFSRSRDVGQVLSSEDAIYADYDLIFASSDTQKRSSENKMLVFSGTQ 105 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,941,206 Number of Sequences: 59808 Number of extensions: 273116 Number of successful extensions: 506 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 444 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 495 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1757375282 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -