BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11d08 (691 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g56400.1 68416.m06272 WRKY family transcription factor DNA-bi... 33 0.24 At1g69050.1 68414.m07901 expressed protein 29 2.2 At4g27520.1 68417.m03952 plastocyanin-like domain-containing pro... 28 5.1 At3g16560.1 68416.m02116 protein phosphatase 2C-related / PP2C-r... 27 8.9 >At3g56400.1 68416.m06272 WRKY family transcription factor DNA-binding protein 4 WRKY4 - Nicotiana tabacum, EMBL:AF193771 Length = 294 Score = 32.7 bits (71), Expect = 0.24 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = +3 Query: 393 GRDVTKVLEACAEQPGASPEDVAWNIFRCGYNRKAVLFDYMPAGGASS 536 G D+T L+ QPG+ ED+ I C N +VL + P +SS Sbjct: 18 GHDLTTQLQQLLSQPGSGLEDLVAKILVCFNNTISVLDTFEPISSSSS 65 >At1g69050.1 68414.m07901 expressed protein Length = 94 Score = 29.5 bits (63), Expect = 2.2 Identities = 23/63 (36%), Positives = 29/63 (46%), Gaps = 3/63 (4%) Frame = +1 Query: 403 SPRCWRRAPSSPALVPRTWPGIYSDAATTG---RRCCSTTCPPVAPLAATRRIIPSYLVP 573 S R RRAP L PR P + + TTG C P+ PL + ++PS L P Sbjct: 30 SCRLQRRAPCPLLLPPRPPPSAEAPSTTTGVSTSTFCQNGTDPI-PLLSP-LVLPSMLQP 87 Query: 574 IPT 582 PT Sbjct: 88 NPT 90 >At4g27520.1 68417.m03952 plastocyanin-like domain-containing protein similar to PIR|JC7196 phytocyanin-related protein Pn14 {Ipomoea nil}; contains Pfam profile PF02298: Plastocyanin-like domain Length = 349 Score = 28.3 bits (60), Expect = 5.1 Identities = 23/58 (39%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +1 Query: 391 PGVTSPRCWRRAP-SSPALVPRTWPGIYSDAATTGRRCCSTTCPPVAPLAATRRIIPS 561 PG T+P +P SS A+ P T P S A +G TT PP AP +T + PS Sbjct: 175 PGSTTPPGGAHSPKSSSAVSPATSPP-GSMAPKSGSPVSPTTSPP-APPKSTSPVSPS 230 >At3g16560.1 68416.m02116 protein phosphatase 2C-related / PP2C-related contains protein phosphatase 2C domain Length = 493 Score = 27.5 bits (58), Expect = 8.9 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = +1 Query: 391 PGVTSPRCWRRAPSSPALVPRTWPGIYSDAATTGRRCCSTTCP 519 P + SP+ +R+ PSSPAL + C S+T P Sbjct: 79 PSLDSPKSFRKVPSSPALSKLDILSPSLHGSMVSLSCSSSTSP 121 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,290,572 Number of Sequences: 28952 Number of extensions: 243502 Number of successful extensions: 737 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 720 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 735 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1467502800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -