BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11d07 (706 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 24 4.1 AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical prote... 24 4.1 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 24 5.4 DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted ... 23 7.1 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 24.2 bits (50), Expect = 4.1 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +3 Query: 417 FPETDGFSFQDIVFITTYSRSW 482 FPE+ GF +QD + ++ W Sbjct: 508 FPESSGFLYQDCLNRASFPAQW 529 >AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical protein protein. Length = 226 Score = 24.2 bits (50), Expect = 4.1 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 Query: 74 CPPVCSPPDCRPICGPAS 127 C CSP C P C P S Sbjct: 150 CLSKCSPTKCVPFCRPFS 167 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 23.8 bits (49), Expect = 5.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +2 Query: 620 LISCIYTRTFLRLNFATFHYKLA 688 LIS + + +NF+TFH LA Sbjct: 575 LISNFFLAAYCLVNFSTFHASLA 597 >DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted polypeptide protein. Length = 125 Score = 23.4 bits (48), Expect = 7.1 Identities = 13/36 (36%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +2 Query: 74 CPPV--CSPPDCRPICGPASPLLCQSSV-PPTQRCY 172 C P C P + CGP L C +V RCY Sbjct: 49 CVPTKECPPDEVFKCCGPCYQLNCYGTVLDCAGRCY 84 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 663,984 Number of Sequences: 2352 Number of extensions: 13644 Number of successful extensions: 35 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -