BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11c16 (722 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g05270.1 68416.m00575 expressed protein similar to endosome-a... 30 1.8 At4g16530.1 68417.m02502 expressed protein contains Pfam profile... 28 5.5 At3g46140.1 68416.m04993 protein kinase-related contains eukaryo... 28 5.5 At5g44990.1 68418.m05517 hypothetical protein 27 9.5 At3g45790.1 68416.m04955 protein kinase-related contains eukaryo... 27 9.5 >At3g05270.1 68416.m00575 expressed protein similar to endosome-associated protein (EEA1) (GI:1016368) [Homo sapiens]; similar to smooth muscle myosin heavy chain (GI:4417214) [Homo sapiens; contains Pfam profile PF05911: Plant protein of unknown function (DUF869) Length = 615 Score = 29.9 bits (64), Expect = 1.8 Identities = 28/90 (31%), Positives = 43/90 (47%), Gaps = 3/90 (3%) Frame = +3 Query: 222 DSRKTISKIN--INE*FQYLKTKIPRISDAKLK-EEIFVDQQILT*ANER*KF*FEVERS 392 +S K + K N +N+ LKT + RIS+ + K E + V++ L A K E +S Sbjct: 329 ESNKELEKSNAHVNQLKHELKTSLRRISELEEKVEMVEVEKLQLEMALNGSKEQIEALQS 388 Query: 393 RKKSLGGFCESLS*FSWEQKK*ELLTNHSG 482 R K + G + E ++ ELL SG Sbjct: 389 RLKEIEGKLSEMKKLEAENQELELLLGESG 418 >At4g16530.1 68417.m02502 expressed protein contains Pfam profile PF04510: Family of unknown function (DUF577) Length = 774 Score = 28.3 bits (60), Expect = 5.5 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = -2 Query: 583 IRLQDFQERDLKESRKNKS*VTYCILKLYKQK 488 + +Q+ +E D+K RK S VTY +++L+K K Sbjct: 113 LTMQETKESDIKILRKIVSFVTYNVVELHKDK 144 >At3g46140.1 68416.m04993 protein kinase-related contains eukaryotic protein kinase domain, INTERPRO:IPR000719 Length = 376 Score = 28.3 bits (60), Expect = 5.5 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = +1 Query: 481 ELLFAYKALGCNMSLKIYFSDSLLDLFPENLGAVSDEYGERFHQDIMH 624 E LF + N+ L+ SL DL +NLG +S++ + +DI++ Sbjct: 164 ETLFGGERTNYNLILEYCSGKSLFDLVNDNLGGLSEKDVKLLARDILY 211 >At5g44990.1 68418.m05517 hypothetical protein Length = 350 Score = 27.5 bits (58), Expect = 9.5 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 Query: 550 LDLFPENLGAVSDEYGERFHQDI 618 LDL+P NL A+ DE E H I Sbjct: 162 LDLYPPNLRAIIDETNEWIHDGI 184 >At3g45790.1 68416.m04955 protein kinase-related contains eukaryotic protein kinase domain, INTERPRO:IPR000719 Length = 376 Score = 27.5 bits (58), Expect = 9.5 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +1 Query: 481 ELLFAYKALGCNMSLKIYFSDSLLDLFPENLGAVSDEYGERFHQDIMH 624 E LF + N+ L+ SL DL NLG +S++ + +DI++ Sbjct: 164 ETLFGGERTNYNLILEYCSGKSLFDLVNSNLGGLSEKDVKLLARDILY 211 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,817,014 Number of Sequences: 28952 Number of extensions: 302569 Number of successful extensions: 645 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 635 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 645 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1575119672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -