BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11c06 (423 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g47128.1 68414.m05222 cysteine proteinase (RD21A) / thiol pro... 28 2.3 At3g04570.1 68416.m00485 DNA-binding protein-related contains Pf... 27 6.9 >At1g47128.1 68414.m05222 cysteine proteinase (RD21A) / thiol protease identical to SP|P43297 Cysteine proteinase RD21A precursor (EC 3.4.22.-) {Arabidopsis thaliana}, thiol protease RD21A SP:P43297 from [Arabidopsis thaliana] Length = 462 Score = 28.3 bits (60), Expect = 2.3 Identities = 12/37 (32%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +1 Query: 208 CYCWNPCAKPA--CCSNEYWCYTRHRPTSTLQETTTL 312 C+ W C A CC + Y C P L + T L Sbjct: 397 CFAWGCCPLEAATCCDDNYSCCPHEYPVCDLDQGTCL 433 >At3g04570.1 68416.m00485 DNA-binding protein-related contains Pfam domain PF03479: Domain of unknown function (DUF296), found in AT-hook motifs Pfam:PF02178 Length = 315 Score = 26.6 bits (56), Expect = 6.9 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 287 ARYKRQPLSEEEIAYINGGG 346 A Y+R PL EEE A GGG Sbjct: 230 ATYERLPLEEEEAAERGGGG 249 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,740,054 Number of Sequences: 28952 Number of extensions: 105016 Number of successful extensions: 226 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 218 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 226 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 655255392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -