BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11c05 (710 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g06744.1 68417.m01106 leucine-rich repeat family protein / ex... 29 3.0 At5g12970.1 68418.m01487 C2 domain-containing protein contains I... 28 5.3 At1g28420.1 68414.m03494 homeobox transcription factor, putative... 28 7.0 At1g27630.1 68414.m03375 cyclin family protein similar to cyclin... 28 7.0 >At4g06744.1 68417.m01106 leucine-rich repeat family protein / extensin family protein similar to leucine-rich repeat/extensin 1 (GI:13809918) {Arabidopsis thaliana}; contains Pfam PF00560: Leucine Rich Repeat domains Length = 404 Score = 29.1 bits (62), Expect = 3.0 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +3 Query: 336 PLPHNVRHSLSLITGVYLLYNNIGSAIFWTIGLTTGS 446 PLP ++ S+S +T V L N+ I IG TG+ Sbjct: 229 PLPRSILRSMSTLTEVLFLNNDFTGCIPHEIGFLTGA 265 >At5g12970.1 68418.m01487 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 769 Score = 28.3 bits (60), Expect = 5.3 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +3 Query: 399 NIGSAIFWTIG-LTTGSYTMITVLSWTKSKRRSLFVSFTIITFLLL 533 +IG + IG L T +++LSW + +LFV F +I ++L Sbjct: 679 SIGGRVQTVIGDLATQGERFLSLLSWRDPRATTLFVLFCLIAAIVL 724 >At1g28420.1 68414.m03494 homeobox transcription factor, putative similar to homeobox transcription factor Hox7 GI:19486 [Lycopersicon peruvianum] Length = 1703 Score = 27.9 bits (59), Expect = 7.0 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = +3 Query: 321 TIQFLPLPHNVRHSLSLITGVYLLYNNIGSAIFWTIGLTTGSYTMITV 464 T++ + H+ RH +++ GV + + W GLT G Y ++V Sbjct: 901 TMKSIVPQHSERHKNTVVGGVDAVIDESNQGQSWIQGLTEGDYCHLSV 948 >At1g27630.1 68414.m03375 cyclin family protein similar to cyclin T1 [Homo sapiens] GI:2981196; contains Pfam profile PF00134: Cyclin, N-terminal domain Length = 317 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/54 (29%), Positives = 25/54 (46%) Frame = -1 Query: 272 SFVHSWFCTHR*VRPSIFGVNIFCIHLVKFFQNTKFSSIFEFSLSFHETFHVVK 111 +FVH W T ++ + +HL FQN K S ++ L F T ++K Sbjct: 202 NFVHDWIRTTLCLQYKPHVIATATVHLAATFQNAKVGSRRDWWLEFGVTTKLLK 255 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,455,531 Number of Sequences: 28952 Number of extensions: 292305 Number of successful extensions: 722 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 700 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 722 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1535986264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -