BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11b12 (652 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L36067-1|AAA29362.1| 229|Anopheles gambiae polyubiquitin protein. 41 4e-05 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 6.3 >L36067-1|AAA29362.1| 229|Anopheles gambiae polyubiquitin protein. Length = 229 Score = 40.7 bits (91), Expect = 4e-05 Identities = 19/50 (38%), Positives = 32/50 (64%) Frame = +1 Query: 133 ELSPSDSVAMLKIAIENATGVRPDRQKLLNVKFEGKVATDNCTLADLNLK 282 E+ PSD++ +K I++ G+ PD+Q+L+ F GK D TL+D N++ Sbjct: 16 EVEPSDTIENVKAKIQDKEGIPPDQQRLI---FAGKQLEDGRTLSDYNIQ 62 Score = 40.7 bits (91), Expect = 4e-05 Identities = 19/50 (38%), Positives = 32/50 (64%) Frame = +1 Query: 133 ELSPSDSVAMLKIAIENATGVRPDRQKLLNVKFEGKVATDNCTLADLNLK 282 E+ PSD++ +K I++ G+ PD+Q+L+ F GK D TL+D N++ Sbjct: 92 EVEPSDTIENVKAKIQDKEGIPPDQQRLI---FAGKQLEDGRTLSDYNIQ 138 Score = 40.7 bits (91), Expect = 4e-05 Identities = 19/50 (38%), Positives = 32/50 (64%) Frame = +1 Query: 133 ELSPSDSVAMLKIAIENATGVRPDRQKLLNVKFEGKVATDNCTLADLNLK 282 E+ PSD++ +K I++ G+ PD+Q+L+ F GK D TL+D N++ Sbjct: 168 EVEPSDTIENVKAKIQDKEGIPPDQQRLI---FAGKQLEDGRTLSDYNIQ 214 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.4 bits (48), Expect = 6.3 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 Query: 91 KLSVRWNGKEFEI 129 KLS WNG+EF + Sbjct: 1612 KLSFSWNGQEFNL 1624 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 640,825 Number of Sequences: 2352 Number of extensions: 11972 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -