BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11b09 (729 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g36020.1 68417.m05128 cold-shock DNA-binding family protein c... 65 4e-11 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 63 2e-10 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 62 3e-10 At2g17870.1 68415.m02070 cold-shock DNA-binding family protein c... 56 2e-08 At2g33620.3 68415.m04122 DNA-binding family protein / AT-hook pr... 29 4.2 At2g33620.2 68415.m04121 DNA-binding family protein / AT-hook pr... 29 4.2 At2g33620.1 68415.m04120 DNA-binding family protein / AT-hook pr... 29 4.2 At1g27620.1 68414.m03373 transferase family protein similar to h... 28 5.5 At1g76470.1 68414.m08895 cinnamoyl-CoA reductase family similar ... 28 7.3 At5g50800.1 68418.m06293 nodulin MtN3 family protein similar to ... 27 9.6 At5g45190.1 68418.m05547 cyclin family protein similar to cyclin... 27 9.6 At4g19600.1 68417.m02880 cyclin family protein similar to cyclin... 27 9.6 >At4g36020.1 68417.m05128 cold-shock DNA-binding family protein contains Pfam domains, PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 299 Score = 65.3 bits (152), Expect = 4e-11 Identities = 34/80 (42%), Positives = 47/80 (58%), Gaps = 1/80 (1%) Frame = +3 Query: 201 AEKVSGTVKWFNVKSGYGFINRNDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVA 380 A + +G V WFN GYGFI +D ++FVHQ++I + RS+ G+AVEFA+ Sbjct: 8 AARSTGKVNWFNASKGYGFITPDDGSVELFVHQSSIV----SEGYRSLTVGDAVEFAITQ 63 Query: 381 GEKG-FEAAGVTGPGGEPVK 437 G G +A VT PGG +K Sbjct: 64 GSDGKTKAVNVTAPGGGSLK 83 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 62.9 bits (146), Expect = 2e-10 Identities = 33/81 (40%), Positives = 50/81 (61%), Gaps = 1/81 (1%) Frame = +3 Query: 204 EKVSGTVKWFNVKSGYGFINRNDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAG 383 ++ GTVKWF+ + G+GFI +D +D+FVHQ++I + RS+ E+VEF V Sbjct: 13 DRRKGTVKWFDTQKGFGFITPSDGGDDLFVHQSSIR----SEGFRSLAAEESVEFDVEVD 68 Query: 384 EKGF-EAAGVTGPGGEPVKGS 443 G +A V+GP G PV+G+ Sbjct: 69 NSGRPKAIEVSGPDGAPVQGN 89 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 62.5 bits (145), Expect = 3e-10 Identities = 33/81 (40%), Positives = 50/81 (61%), Gaps = 1/81 (1%) Frame = +3 Query: 204 EKVSGTVKWFNVKSGYGFINRNDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAV-VA 380 E+ G+VKWF+ + G+GFI +D +D+FVHQ++I + RS+ EAVEF V + Sbjct: 9 ERRKGSVKWFDTQKGFGFITPDDGGDDLFVHQSSIR----SEGFRSLAAEEAVEFEVEID 64 Query: 381 GEKGFEAAGVTGPGGEPVKGS 443 +A V+GP G PV+G+ Sbjct: 65 NNNRPKAIDVSGPDGAPVQGN 85 >At2g17870.1 68415.m02070 cold-shock DNA-binding family protein contains Pfam domains, PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 301 Score = 56.0 bits (129), Expect = 2e-08 Identities = 31/76 (40%), Positives = 44/76 (57%), Gaps = 1/76 (1%) Frame = +3 Query: 201 AEKVSGTVKWFNVKSGYGFINRNDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVA 380 A + G V WF+ GYGFI +D E++FVHQ++I + RS+ GE+VE+ + Sbjct: 8 AARSIGKVSWFSDGKGYGFITPDDGGEELFVHQSSIVSD----GFRSLTLGESVEYEIAL 63 Query: 381 GEKG-FEAAGVTGPGG 425 G G +A VT PGG Sbjct: 64 GSDGKTKAIEVTAPGG 79 >At2g33620.3 68415.m04122 DNA-binding family protein / AT-hook protein 1 (AHP1) identical to AT-hook protein 1 [Arabidopsis thaliana] gi|2598227|emb|CAA10857 Length = 351 Score = 28.7 bits (61), Expect = 4.2 Identities = 19/49 (38%), Positives = 24/49 (48%) Frame = +3 Query: 339 SVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAADKRRGYHRQY 485 S G+ + + GE G G+TG G EPVK KRRG R+Y Sbjct: 69 SAGENSVLNMNLPGGESG----GMTGTGSEPVK-------KRRGRPRKY 106 >At2g33620.2 68415.m04121 DNA-binding family protein / AT-hook protein 1 (AHP1) identical to AT-hook protein 1 [Arabidopsis thaliana] gi|2598227|emb|CAA10857 Length = 351 Score = 28.7 bits (61), Expect = 4.2 Identities = 19/49 (38%), Positives = 24/49 (48%) Frame = +3 Query: 339 SVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAADKRRGYHRQY 485 S G+ + + GE G G+TG G EPVK KRRG R+Y Sbjct: 69 SAGENSVLNMNLPGGESG----GMTGTGSEPVK-------KRRGRPRKY 106 >At2g33620.1 68415.m04120 DNA-binding family protein / AT-hook protein 1 (AHP1) identical to AT-hook protein 1 [Arabidopsis thaliana] gi|2598227|emb|CAA10857 Length = 351 Score = 28.7 bits (61), Expect = 4.2 Identities = 19/49 (38%), Positives = 24/49 (48%) Frame = +3 Query: 339 SVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAADKRRGYHRQY 485 S G+ + + GE G G+TG G EPVK KRRG R+Y Sbjct: 69 SAGENSVLNMNLPGGESG----GMTGTGSEPVK-------KRRGRPRKY 106 >At1g27620.1 68414.m03373 transferase family protein similar to hypersensitivity-related gene product HSR201 - Nicotiana tabacum, EMBL:X95343; contains Pfam transferase family domain PF00248 Length = 442 Score = 28.3 bits (60), Expect = 5.5 Identities = 21/73 (28%), Positives = 30/73 (41%), Gaps = 6/73 (8%) Frame = -1 Query: 630 KNCAEMVQCXXXXXXXXXXXLGWAGVHDVLILLCVELLH------RLVRHLDEGNIGGGS 469 K CA ++C WA D+ + + V+LL RL L +G G G Sbjct: 248 KTCAPSLKCTTFEALAANTWRSWAQSLDLPMTMLVKLLFSVNMRKRLTPELPQGYYGNGF 307 Query: 468 HGACLQHKVSLLL 430 AC + KV L+ Sbjct: 308 VLACAESKVQDLV 320 >At1g76470.1 68414.m08895 cinnamoyl-CoA reductase family similar to cinnamoyl-CoA reductase GB:CAA56103 [Eucalyptus gunnii], Pinus taeda [GI:17978649]; contains non-consensus GG acceptor splice site at exon 4 Length = 317 Score = 27.9 bits (59), Expect = 7.3 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -2 Query: 647 AKIATEKTALRWYNASFLTLISLCTPLV 564 AK TE+ AL W +F +++LC ++ Sbjct: 158 AKTLTEREALEWSKRNFADVVTLCPSVI 185 >At5g50800.1 68418.m06293 nodulin MtN3 family protein similar to MtN3 GI:1619602 (root nodule development) from [Medicago truncatula] Length = 294 Score = 27.5 bits (58), Expect = 9.6 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +1 Query: 307 SPVTTHVRLCARSATERRWSLPWL 378 +PV T VR+C + +TE SLP++ Sbjct: 26 APVPTFVRICKKKSTEGFQSLPYV 49 >At5g45190.1 68418.m05547 cyclin family protein similar to cyclin T1 [Equus caballus] GI:5052355; contains Pfam profile PF00134: Cyclin, N-terminal domain Length = 579 Score = 27.5 bits (58), Expect = 9.6 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 89 GERRWWQRW*NTPRPLLDV 33 GE+ WWQ + TPR L DV Sbjct: 241 GEKVWWQEFDVTPRQLEDV 259 >At4g19600.1 68417.m02880 cyclin family protein similar to cyclin T2a [Homo sapiens] GI:2981198; contains Pfam profile PF00134: Cyclin, N-terminal domain Length = 541 Score = 27.5 bits (58), Expect = 9.6 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 89 GERRWWQRW*NTPRPLLDV 33 GE+ WWQ + TPR L DV Sbjct: 241 GEKVWWQEFDVTPRQLEDV 259 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,940,892 Number of Sequences: 28952 Number of extensions: 210641 Number of successful extensions: 735 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 719 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 731 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1594686376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -