BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11a18 (684 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 23 2.3 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 21 7.1 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 21 7.1 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 7.1 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 7.1 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 9.4 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 9.4 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 9.4 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 9.4 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 23.0 bits (47), Expect = 2.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 396 VESCHSGFSNSS 431 V SCH GFS+S+ Sbjct: 135 VSSCHQGFSSST 146 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.4 bits (43), Expect = 7.1 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -2 Query: 545 PGAFKLEHRPLGRCSV 498 PGA+ ++ R LG C + Sbjct: 403 PGAYWIQLRGLGECGI 418 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.4 bits (43), Expect = 7.1 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -2 Query: 545 PGAFKLEHRPLGRCSV 498 PGA+ ++ R LG C + Sbjct: 403 PGAYWIQLRGLGECGI 418 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 7.1 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -3 Query: 676 MNINFLRLDISSPICNLRYPNARSSSENCV 587 M+I R+ + P LRYPN + ++EN V Sbjct: 1426 MSIAPNRVSQARPSVQLRYPNGK-ANENFV 1454 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 7.1 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -3 Query: 676 MNINFLRLDISSPICNLRYPNARSSSENCV 587 M+I R+ + P LRYPN + ++EN V Sbjct: 1426 MSIAPNRVSQARPSVQLRYPNGK-ANENFV 1454 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.4 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 123 GLRTGWPCFKPSSLRLWIF 67 GLR G PCF ++ ++F Sbjct: 428 GLRNGDPCFFHDTIPPYLF 446 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.4 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 123 GLRTGWPCFKPSSLRLWIF 67 GLR G PCF ++ ++F Sbjct: 428 GLRNGDPCFFHDTIPPYLF 446 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.4 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 123 GLRTGWPCFKPSSLRLWIF 67 GLR G PCF ++ ++F Sbjct: 428 GLRNGDPCFFHDTIPPYLF 446 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.4 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 123 GLRTGWPCFKPSSLRLWIF 67 GLR G PCF ++ ++F Sbjct: 428 GLRNGDPCFFHDTIPPYLF 446 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,162 Number of Sequences: 336 Number of extensions: 3307 Number of successful extensions: 10 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17906060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -