BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10p20 (703 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_34766| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 955 Score = 28.3 bits (60), Expect = 6.4 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 618 WENETKPLDVTSRDPPKSPLKKSQTN 695 W++ET P DV PP P++ S + Sbjct: 499 WQDETSPSDVAESPPPIPPIRCSSVS 524 >SB_34766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 740 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +3 Query: 600 CESAQMWENETKPLDVTSRDPPKSPLKKSQTNSL 701 CES Q+ + +P+ + + PKSP K T+ L Sbjct: 365 CESCQLVSSYDRPVPIATTKMPKSPWKFCSTDLL 398 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,708,847 Number of Sequences: 59808 Number of extensions: 405612 Number of successful extensions: 790 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 732 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 789 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1841633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -