BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12a21 (623 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33407| Best HMM Match : UQ_con (HMM E-Value=0) 122 3e-28 SB_7202| Best HMM Match : UQ_con (HMM E-Value=5.9e-05) 106 2e-23 SB_33408| Best HMM Match : UQ_con (HMM E-Value=3.7e-07) 83 2e-16 SB_44322| Best HMM Match : UQ_con (HMM E-Value=1.6e-37) 79 2e-15 SB_15708| Best HMM Match : UQ_con (HMM E-Value=0) 79 2e-15 SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) 72 3e-13 SB_41378| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_5638| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_28696| Best HMM Match : UQ_con (HMM E-Value=5.3e-30) 60 1e-09 SB_28812| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_26076| Best HMM Match : UQ_con (HMM E-Value=3.6e-15) 47 1e-05 SB_26077| Best HMM Match : UQ_con (HMM E-Value=6e-18) 45 4e-05 SB_3717| Best HMM Match : UQ_con (HMM E-Value=0.00017) 45 4e-05 SB_26178| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_21041| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_30411| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_36444| Best HMM Match : UQ_con (HMM E-Value=2.8) 41 7e-04 SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) 40 0.002 SB_26761| Best HMM Match : UQ_con (HMM E-Value=1.7e-06) 40 0.002 SB_38537| Best HMM Match : VWA (HMM E-Value=0) 31 1.0 SB_39170| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_35256| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_40772| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_26293| Best HMM Match : WD40 (HMM E-Value=1.1e-15) 29 3.1 SB_47019| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_43290| Best HMM Match : AMP-binding (HMM E-Value=6.5e-16) 29 4.1 SB_35857| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_33210| Best HMM Match : Spectrin (HMM E-Value=1.3e-12) 28 7.1 SB_47222| Best HMM Match : UQ_con (HMM E-Value=5) 28 7.1 SB_569| Best HMM Match : Big_1 (HMM E-Value=1.1) 27 9.4 >SB_33407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 226 Score = 122 bits (293), Expect = 3e-28 Identities = 58/103 (56%), Positives = 68/103 (66%) Frame = +1 Query: 274 NSQMALKRINRELQDLGRDPPAQCSAGPHGEDLFHWQATIMGPVDSPYQGGVFFLTIHFP 453 N A KRI REL ++ DPP CSAGP G+DL+ W +TI+GP S Y+GGVFFL IHFP Sbjct: 92 NQSTAAKRIQRELTEITLDPPPNCSAGPKGDDLYEWYSTILGPPGSVYEGGVFFLDIHFP 151 Query: 454 TDYPFKPPKVAFTTRIYHPNINSNGSICLDILRAQWSPALTIS 582 +DYPFKPPK G +CLDIL+ WSPALTIS Sbjct: 152 SDYPFKPPK---------------GMVCLDILKDSWSPALTIS 179 >SB_7202| Best HMM Match : UQ_con (HMM E-Value=5.9e-05) Length = 200 Score = 106 bits (254), Expect = 2e-23 Identities = 44/69 (63%), Positives = 52/69 (75%) Frame = +1 Query: 274 NSQMALKRINRELQDLGRDPPAQCSAGPHGEDLFHWQATIMGPVDSPYQGGVFFLTIHFP 453 N A KRI REL ++ DPP CSAGP G+DL+ W +TI+GP S Y+GGVFFL IHFP Sbjct: 132 NQSTAAKRIQRELTEITLDPPPNCSAGPKGDDLYEWYSTILGPPGSVYEGGVFFLDIHFP 191 Query: 454 TDYPFKPPK 480 +DYPFKPPK Sbjct: 192 SDYPFKPPK 200 >SB_33408| Best HMM Match : UQ_con (HMM E-Value=3.7e-07) Length = 181 Score = 82.6 bits (195), Expect = 2e-16 Identities = 34/52 (65%), Positives = 40/52 (76%) Frame = +1 Query: 346 SAGPHGEDLFHWQATIMGPVDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRI 501 SAGP G+ L+ W +TI+GP S Y+GGVFFL IHFPTDYPFKPPKV R+ Sbjct: 43 SAGPKGDKLYEWYSTILGPPGSVYEGGVFFLDIHFPTDYPFKPPKVGQAIRL 94 >SB_44322| Best HMM Match : UQ_con (HMM E-Value=1.6e-37) Length = 190 Score = 79.4 bits (187), Expect = 2e-15 Identities = 40/79 (50%), Positives = 49/79 (62%), Gaps = 4/79 (5%) Frame = +1 Query: 391 IMGPVDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDIL----RAQ 558 ++G +PY G+F L I P YPF+PPKV F T IYHPNI+S+G ICLD L + Sbjct: 2 LIGAEGTPYHKGIFKLDIQIPERYPFEPPKVRFVTPIYHPNIDSSGRICLDTLKMPPKGM 61 Query: 559 WSPALTISXSVALNLLTSM 615 W PAL IS SV +L M Sbjct: 62 WKPALNIS-SVLSTILILM 79 >SB_15708| Best HMM Match : UQ_con (HMM E-Value=0) Length = 145 Score = 79.4 bits (187), Expect = 2e-15 Identities = 33/69 (47%), Positives = 45/69 (65%), Gaps = 1/69 (1%) Frame = +1 Query: 367 DLFHWQATIMGPVDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDI 546 ++ +WQ I+ P PY G F + I FP +YPFKPPK+ F T+IYHPNI+ G +CL I Sbjct: 22 NILYWQGLIV-PEMPPYNKGAFRIEICFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPI 80 Query: 547 LRAQ-WSPA 570 + + W PA Sbjct: 81 ISPENWKPA 89 >SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 1282 Score = 72.1 bits (169), Expect = 3e-13 Identities = 32/89 (35%), Positives = 48/89 (53%), Gaps = 1/89 (1%) Frame = +1 Query: 286 ALKRINRELQDLGRDPPAQCSAG-PHGEDLFHWQATIMGPVDSPYQGGVFFLTIHFPTDY 462 A++ + EL+ L +P + P + F W I GP + Y GG F + FP DY Sbjct: 1125 AVRALQLELKKLTEEPVEGFTVEVPDESNTFEWDVAIFGPPGTLYAGGYFKAHMSFPHDY 1184 Query: 463 PFKPPKVAFTTRIYHPNINSNGSICLDIL 549 P+ PP F T+++HPNI +G +C+ IL Sbjct: 1185 PYSPPTFRFLTKMWHPNIYESGDVCISIL 1213 >SB_41378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 70.9 bits (166), Expect = 8e-13 Identities = 30/79 (37%), Positives = 49/79 (62%), Gaps = 1/79 (1%) Frame = +1 Query: 316 DLGRDPPAQCSAGPHG-EDLFHWQATIMGPVDSPYQGGVFFLTIHFPTDYPFKPPKVAFT 492 +L + P SAG EDL+ W+ ++GP + Y+ G F ++ FP +YP +PP + F Sbjct: 343 ELQKKPVEGFSAGLFDDEDLYKWEIMVVGPPGTYYEEGYFKASMVFPKEYPQRPPTLTFI 402 Query: 493 TRIYHPNINSNGSICLDIL 549 + I+HPN++ NG +C+ IL Sbjct: 403 SDIWHPNVHKNGEVCISIL 421 >SB_5638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 62.9 bits (146), Expect = 2e-10 Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 5/70 (7%) Frame = +1 Query: 355 PHGEDLFHWQATIMGPVDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTR-----IYHPNIN 519 P +D+ A I GP D+PY+GG F+ I P DYP +PP+V T ++PN+ Sbjct: 5 PDKDDIPKIHALITGPFDTPYEGGFFYFLIRCPPDYPIRPPRVKLMTTGSGQVRFNPNLY 64 Query: 520 SNGSICLDIL 549 NG +CL I+ Sbjct: 65 RNGKVCLSII 74 >SB_28696| Best HMM Match : UQ_con (HMM E-Value=5.3e-30) Length = 204 Score = 60.1 bits (139), Expect = 1e-09 Identities = 31/55 (56%), Positives = 36/55 (65%), Gaps = 4/55 (7%) Frame = +1 Query: 463 PFKPPKVAFTTRIYHPNINSNGSICLDIL----RAQWSPALTISXSVALNLLTSM 615 PF+PPKV F T IYHPNI+S+G ICLD L + W PAL IS SV +L M Sbjct: 40 PFEPPKVRFVTPIYHPNIDSSGRICLDTLKMPPKGMWKPALNIS-SVLSTILILM 93 >SB_28812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 385 Score = 55.6 bits (128), Expect = 3e-08 Identities = 30/83 (36%), Positives = 44/83 (53%) Frame = +1 Query: 247 VESQYNST*NSQMALKRINRELQDLGRDPPAQCSAGPHGEDLFHWQATIMGPVDSPYQGG 426 +E QYN A+KR+ RE ++L R+ A P ++LF W T+ GP D+ + GG Sbjct: 1 MEKQYNLR---SPAVKRLMREAKEL-RNATELYHAQPLEDNLFEWHFTVRGPPDTEFAGG 56 Query: 427 VFFLTIHFPTDYPFKPPKVAFTT 495 + I P +YP KPP + T Sbjct: 57 RYHGRIILPPEYPMKPPSIMLLT 79 >SB_26076| Best HMM Match : UQ_con (HMM E-Value=3.6e-15) Length = 243 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/50 (38%), Positives = 29/50 (58%) Frame = +1 Query: 400 PVDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDIL 549 P D Y+GG F ++ TDYP P + T+IYHPN++ +C+ +L Sbjct: 45 PTDGAYRGGQFKFSVR-TTDYPNVAPSINCKTKIYHPNMDGYDGVCMSLL 93 >SB_26077| Best HMM Match : UQ_con (HMM E-Value=6e-18) Length = 215 Score = 45.2 bits (102), Expect = 4e-05 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Frame = +1 Query: 400 PVDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNIN-SNGSICLDIL 549 P D Y+GG F ++ DYP PP IYHPN++ +GS+CL +L Sbjct: 45 PTDGAYRGGQFKFSVK-TEDYPNTPPVPRCVNNIYHPNMDLDDGSVCLSLL 94 >SB_3717| Best HMM Match : UQ_con (HMM E-Value=0.00017) Length = 123 Score = 45.2 bits (102), Expect = 4e-05 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = +1 Query: 364 EDLFHWQATIMGPVDSPYQGGVFFLTIHFPTDYPFKPPKVAFTT 495 ++LF W T+ GP D+ + GG + I P +YP KPP + T Sbjct: 1 DNLFEWHFTVRGPPDTEFAGGRYHGRIILPPEYPMKPPSIMLLT 44 >SB_26178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 897 Score = 45.2 bits (102), Expect = 4e-05 Identities = 36/110 (32%), Positives = 51/110 (46%), Gaps = 10/110 (9%) Frame = +1 Query: 292 KRINRELQDLGRDPPAQCSAGPHGEDLFHWQA---TIMGPV----DSPYQGGVF-FLTIH 447 KR+ +E QD+ R SA ++LF W TI G D G F L I Sbjct: 737 KRLMKEFQDVSRKTERIFSAELVDDNLFEWNVKLHTIDGDSLLYRDMVETGSKFILLNIT 796 Query: 448 FPTDYPFKPPKV-AFTTRIYHPNINSNGSICLDILRAQ-WSPALTISXSV 591 FP ++PF PP + RI + G+IC+++L + WS A T+ V Sbjct: 797 FPENFPFAPPFMRVLAPRIEGGFVLDGGAICMELLTPKGWSSAYTVEAVV 846 >SB_21041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 44.4 bits (100), Expect = 8e-05 Identities = 32/101 (31%), Positives = 45/101 (44%) Frame = +1 Query: 277 SQMALKRINRELQDLGRDPPAQCSAGPHGEDLFHWQATIMGPVDSPYQGGVFFLTIHFPT 456 S +K++ RE+ L DPP + ED+ QA+I GP FFLT Sbjct: 103 SPQIIKQVAREIHGLTNDPPEGIKVFSNDEDITDIQASIEGPR--------FFLT----- 149 Query: 457 DYPFKPPKVAFTTRIYHPNINSNGSICLDILRAQWSPALTI 579 +I+HPN+ NG IC++ L+ W P L I Sbjct: 150 -------------KIFHPNVAKNGEICVNTLKKDWKPDLGI 177 >SB_30411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 710 Score = 42.3 bits (95), Expect = 3e-04 Identities = 18/36 (50%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +1 Query: 397 GPVDSPYQGGVFFLTIHFPTDYPFKPPKVA-FTTRI 501 GPV +PY+GGV+ + + P YPFK P +A FT I Sbjct: 56 GPVGTPYEGGVWKVRVDLPEKYPFKSPSIANFTIEI 91 >SB_36444| Best HMM Match : UQ_con (HMM E-Value=2.8) Length = 55 Score = 41.1 bits (92), Expect = 7e-04 Identities = 18/38 (47%), Positives = 21/38 (55%) Frame = +1 Query: 382 QATIMGPVDSPYQGGVFFLTIHFPTDYPFKPPKVAFTT 495 +A + GPVD+PY G F I FP YP PP V T Sbjct: 9 RALVTGPVDTPYSRGCFVFDIFFPGTYPNVPPLVKLIT 46 >SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) Length = 841 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +1 Query: 391 IMGPVDSPYQGGVFFLTIHFPTDYPFKPPK 480 I GP ++P++GG + L I P YPF PPK Sbjct: 693 IRGPPETPFEGGTYNLDIVIPETYPFNPPK 722 >SB_26761| Best HMM Match : UQ_con (HMM E-Value=1.7e-06) Length = 739 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 3/57 (5%) Frame = +1 Query: 379 WQATIMGPVDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRI---YHPNINSNGSICL 540 ++ I GP +PY G+F I P +YP PP + + +PN+ +G +C+ Sbjct: 636 FRVMIEGPAGTPYDHGLFAFDILLPANYPDAPPSFHYLSMCNGRLNPNLYEDGKVCI 692 >SB_38537| Best HMM Match : VWA (HMM E-Value=0) Length = 1174 Score = 30.7 bits (66), Expect = 1.0 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +1 Query: 7 CCSPFAEKCLISINSCFVPIIISFVL 84 C A+KC+ + +CFVPI ++F++ Sbjct: 507 CLRGCAKKCVPKVKTCFVPIDVAFIM 532 >SB_39170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 415 YQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNG 528 ++ ++ L I +YP KPP V F ++I +NS G Sbjct: 3 FENRIYNLKIVCGPNYPQKPPTVKFVSKINMNGVNSKG 40 >SB_35256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 415 YQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNG 528 ++ ++ L I +YP KPP V F ++I +NS G Sbjct: 3 FENRIYNLKIVCGPNYPQKPPTVKFVSKINMNGVNSKG 40 >SB_40772| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 29.5 bits (63), Expect = 2.3 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 460 YPFKPPKVAFTTRIYHPNINSNG 528 +P P V FT+ ++HP I+ NG Sbjct: 118 FPDSRPLVKFTSNVFHPQIHENG 140 >SB_26293| Best HMM Match : WD40 (HMM E-Value=1.1e-15) Length = 140 Score = 29.1 bits (62), Expect = 3.1 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -3 Query: 435 EENSSLIRTVNWAHNCGLPMEQIFTV-WACRTLCW 334 E +S +R V WA N GLP I + CR + W Sbjct: 35 EAHSDWVRDVAWAPNVGLPTSTIASCSQDCRVIIW 69 >SB_47019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 4.1 Identities = 17/70 (24%), Positives = 32/70 (45%), Gaps = 2/70 (2%) Frame = +1 Query: 301 NRELQDLGRDPPAQCSAGPHGEDLFHWQATIMGPVDSP--YQGGVFFLTIHFPTDYPFKP 474 ++E++++ + PP G G + W + +DS + G+ + TD F+ Sbjct: 89 DKEIENIRKPPPPLVPLGRQGTECKTWLRMQLHDIDSDVRMRSGLRMKGTYNDTDIDFEE 148 Query: 475 PKVAFTTRIY 504 A TTR+Y Sbjct: 149 ISKAETTRLY 158 >SB_43290| Best HMM Match : AMP-binding (HMM E-Value=6.5e-16) Length = 980 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +1 Query: 364 EDLFHWQATIMGPVDSPYQGGVFFLTIHFPTDYP 465 E+ F W + ++ VDS + GGV+ L + P P Sbjct: 186 EESFQWMSHVLPAVDSIHSGGVYCLCLVPPGGLP 219 >SB_35857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2680 Score = 27.9 bits (59), Expect = 7.1 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -1 Query: 413 GLSTGPIIVACQWNRSS-PCGPAEHCAGGSLPRSCNS 306 GL + A WN S C P A GSL +CNS Sbjct: 803 GLRCDQCVSAYYWNPSGYGCSPCNCDASGSLATNCNS 839 >SB_33210| Best HMM Match : Spectrin (HMM E-Value=1.3e-12) Length = 186 Score = 27.9 bits (59), Expect = 7.1 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +2 Query: 329 IHQHNVRQAHTVKICSIGKPQLWAQLTVLIKE 424 +H+ N + +++C QLW L VLIK+ Sbjct: 56 LHRENYHDSERIQVCKGRIIQLWELLLVLIKQ 87 >SB_47222| Best HMM Match : UQ_con (HMM E-Value=5) Length = 46 Score = 27.9 bits (59), Expect = 7.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 590 LLSICSLLCDP 622 LLSICSLLCDP Sbjct: 2 LLSICSLLCDP 12 >SB_569| Best HMM Match : Big_1 (HMM E-Value=1.1) Length = 256 Score = 27.5 bits (58), Expect = 9.4 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +2 Query: 521 VMVPSVLTFCVHSGHQRSPYPKVLLSICSLLCDP 622 V + S+L F HSG + P P + LS+ S +P Sbjct: 220 VTLESILLFWRHSGERHKPEPPLSLSLTSRQKEP 253 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,295,965 Number of Sequences: 59808 Number of extensions: 439042 Number of successful extensions: 943 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 833 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 938 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1548368000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -