BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12a19 (598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56974| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_16061| Best HMM Match : 7tm_1 (HMM E-Value=5.9) 28 6.6 >SB_56974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 785 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = +3 Query: 183 SASSTKAPVPPKEQNLRKESPRRLE 257 +ASS +APV K++ L++E RRLE Sbjct: 144 AASSNRAPVSEKDRVLQEERKRRLE 168 >SB_16061| Best HMM Match : 7tm_1 (HMM E-Value=5.9) Length = 119 Score = 27.9 bits (59), Expect = 6.6 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Frame = -2 Query: 474 WQ-YFIASFVI*FRV--GIPL*SMALMKAVNSCLYW 376 WQ F+ F+I F V +PL +MA++ ++ CL W Sbjct: 78 WQRQFMIEFIIKFMVTYAVPLLTMAILYSIIVCLLW 113 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,040,377 Number of Sequences: 59808 Number of extensions: 379809 Number of successful extensions: 938 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 879 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 938 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -