BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11o24 (159 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83117-6|CAN86902.1| 1931|Caenorhabditis elegans Hypothetical pr... 25 5.5 Z83117-5|CAN86901.1| 1971|Caenorhabditis elegans Hypothetical pr... 25 5.5 Z83117-4|CAB05572.2| 2032|Caenorhabditis elegans Hypothetical pr... 25 5.5 Z80219-10|CAN86596.1| 1931|Caenorhabditis elegans Hypothetical p... 25 5.5 Z80219-9|CAN86595.1| 1971|Caenorhabditis elegans Hypothetical pr... 25 5.5 Z80219-8|CAB02303.2| 2032|Caenorhabditis elegans Hypothetical pr... 25 5.5 Z70267-4|CAA94210.1| 314|Caenorhabditis elegans Hypothetical pr... 25 5.5 AJ276020-1|CAC81668.1| 1971|Caenorhabditis elegans putative TRP ... 25 5.5 U23180-3|AAC46729.2| 856|Caenorhabditis elegans Hypothetical pr... 25 9.6 >Z83117-6|CAN86902.1| 1931|Caenorhabditis elegans Hypothetical protein T01H8.5d protein. Length = 1931 Score = 25.4 bits (53), Expect = 5.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 89 SLKVFITNNVFKKPLDFNSDC 151 SLK+F+ N+ +K DF DC Sbjct: 1522 SLKLFLDNDQIEKLHDFEEDC 1542 >Z83117-5|CAN86901.1| 1971|Caenorhabditis elegans Hypothetical protein T01H8.5c protein. Length = 1971 Score = 25.4 bits (53), Expect = 5.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 89 SLKVFITNNVFKKPLDFNSDC 151 SLK+F+ N+ +K DF DC Sbjct: 1562 SLKLFLDNDQIEKLHDFEEDC 1582 >Z83117-4|CAB05572.2| 2032|Caenorhabditis elegans Hypothetical protein T01H8.5a protein. Length = 2032 Score = 25.4 bits (53), Expect = 5.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 89 SLKVFITNNVFKKPLDFNSDC 151 SLK+F+ N+ +K DF DC Sbjct: 1623 SLKLFLDNDQIEKLHDFEEDC 1643 >Z80219-10|CAN86596.1| 1931|Caenorhabditis elegans Hypothetical protein T01H8.5d protein. Length = 1931 Score = 25.4 bits (53), Expect = 5.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 89 SLKVFITNNVFKKPLDFNSDC 151 SLK+F+ N+ +K DF DC Sbjct: 1522 SLKLFLDNDQIEKLHDFEEDC 1542 >Z80219-9|CAN86595.1| 1971|Caenorhabditis elegans Hypothetical protein T01H8.5c protein. Length = 1971 Score = 25.4 bits (53), Expect = 5.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 89 SLKVFITNNVFKKPLDFNSDC 151 SLK+F+ N+ +K DF DC Sbjct: 1562 SLKLFLDNDQIEKLHDFEEDC 1582 >Z80219-8|CAB02303.2| 2032|Caenorhabditis elegans Hypothetical protein T01H8.5a protein. Length = 2032 Score = 25.4 bits (53), Expect = 5.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 89 SLKVFITNNVFKKPLDFNSDC 151 SLK+F+ N+ +K DF DC Sbjct: 1623 SLKLFLDNDQIEKLHDFEEDC 1643 >Z70267-4|CAA94210.1| 314|Caenorhabditis elegans Hypothetical protein K04C1.3 protein. Length = 314 Score = 25.4 bits (53), Expect = 5.5 Identities = 10/42 (23%), Positives = 22/42 (52%) Frame = -3 Query: 136 IQRFLEHVIRDEHF*AFPAYRIHRGRHXTFRHFENIQTKQAY 11 ++ +L+H I+ E IH+ + + + N+QT+ +Y Sbjct: 84 LRHYLQHFIKIEEARYMQLGVIHKDNYASLKEAMNVQTRSSY 125 >AJ276020-1|CAC81668.1| 1971|Caenorhabditis elegans putative TRP homologous cationchannel protein. Length = 1971 Score = 25.4 bits (53), Expect = 5.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 89 SLKVFITNNVFKKPLDFNSDC 151 SLK+F+ N+ +K DF DC Sbjct: 1562 SLKLFLDNDQIEKLHDFEEDC 1582 >U23180-3|AAC46729.2| 856|Caenorhabditis elegans Hypothetical protein C28F5.4 protein. Length = 856 Score = 24.6 bits (51), Expect = 9.6 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 77 ISRESLKVFITNNVFKKPLDFNS 145 IS ESLK +TN+ F +P D ++ Sbjct: 558 ISFESLKRTLTNHAFSQPHDLSA 580 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,246,404 Number of Sequences: 27780 Number of extensions: 42839 Number of successful extensions: 106 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 106 length of database: 12,740,198 effective HSP length: 33 effective length of database: 11,823,458 effective search space used: 224645702 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -