BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11o21 (676 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0367 - 2874429-2874483,2876274-2876345,2876453-2879613,287... 33 0.28 02_05_0258 + 27222058-27223198,27223297-27223460,27224399-272245... 30 1.9 11_06_0559 + 24972403-24972445,24972590-24972680,24973911-249740... 29 2.6 03_02_0333 + 7566644-7566995,7567432-7567463,7568301-7568457,756... 29 2.6 03_01_0512 - 3849275-3849333,3849429-3849531,3849610-3849654,384... 29 2.6 02_04_0528 - 23693237-23693328,23694057-23694141,23694282-236943... 29 4.5 01_06_0042 - 25911662-25911736,25912409-25912607,25913275-259133... 28 7.8 >05_01_0367 - 2874429-2874483,2876274-2876345,2876453-2879613, 2879715-2879973,2880060-2880346,2880423-2880758, 2880862-2881003,2881077-2881297,2881379-2881540, 2881617-2881775,2881860-2882159,2882834-2883097, 2883133-2883243,2883902-2883988 Length = 1871 Score = 32.7 bits (71), Expect = 0.28 Identities = 27/101 (26%), Positives = 40/101 (39%), Gaps = 2/101 (1%) Frame = +3 Query: 378 APHYLQETLKHEPKYVLEAAKFEPKYEIEPYYTGEPVPLSNSKYIGSYEPN--VFRAYDS 551 +P Y+ +L H P + +A P Y+ P LS S Y P V+ S Sbjct: 1631 SPSYVPTSLPHSPTSPIYSATSPIYSPSSPIYS--PTSLSYSPTSPVYSPTSPVYNPTSS 1688 Query: 552 NARRSSRSHGALMSPYEAINSSPSFGESFPSVYGSPSKSLY 674 +S S+ Y +SPS+ + PS SP+ Y Sbjct: 1689 AYSPTSPSYNPTSPSYSYSPTSPSYSPTSPSYSYSPTSPSY 1729 >02_05_0258 + 27222058-27223198,27223297-27223460,27224399-27224575, 27224713-27224761,27224991-27225793 Length = 777 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +3 Query: 489 PLSNSKYIGSYEPNVFRAYDSNARRSSRSHGALMSPYEA 605 P S Y GS+EP + Y RR+ R+ SP A Sbjct: 171 PASERVYFGSFEPAQYHPYGGETRRADRAAAPPPSPPRA 209 >11_06_0559 + 24972403-24972445,24972590-24972680,24973911-24974030, 24974121-24974237,24974745-24974840,24975317-24975610, 24977153-24977258,24977365-24977566,24977671-24977792 Length = 396 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/25 (44%), Positives = 16/25 (64%), Gaps = 3/25 (12%) Frame = +2 Query: 17 CHRCCHV---FVNFRHFDFSFNFKR 82 CH+C HV F NF H++F+ K+ Sbjct: 298 CHQCFHVESYFQNFHHYNFNVKIKK 322 >03_02_0333 + 7566644-7566995,7567432-7567463,7568301-7568457, 7568568-7568740,7568872-7568973,7569053-7569199, 7569274-7570248 Length = 645 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 166 GQHQSTAQLSRQPSHPRHVK*PQNRQHWI 252 G Q+TA L+R SH HV NR+ W+ Sbjct: 60 GLPQATASLARSVSHSSHVNHQANRRCWL 88 >03_01_0512 - 3849275-3849333,3849429-3849531,3849610-3849654, 3849876-3849974,3850078-3850146,3850251-3850310, 3850540-3850633,3850875-3850949,3851101-3851219, 3851433-3851600,3852743-3852928 Length = 358 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/58 (25%), Positives = 32/58 (55%), Gaps = 5/58 (8%) Frame = +3 Query: 312 NYPKENSEIISNLARAIDKLPVAPHY---LQETLKHE--PKYVLEAAKFEPKYEIEPY 470 +Y +EN +++ L D + +A HY L++ ++H+ +YVLE+ + ++ Y Sbjct: 143 DYLEENQDLLDVLMSGYDNMDIAIHYSAILRDCIRHQVAARYVLESQHMKKFFDYIQY 200 >02_04_0528 - 23693237-23693328,23694057-23694141,23694282-23694327, 23694444-23694792,23694913-23695192,23695794-23695854, 23695881-23695933 Length = 321 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Frame = +3 Query: 393 QETLKHEPKYVLEAAKFEPKYEIEPYYTGEPVPLSNSKYIGSYE-PNVFRAYDSNAR 560 +E L +Y+L F PKY+ E + ++ +IGSY+ P + YD + + Sbjct: 190 KEFLPQRIRYLLRITTFSPKYD-----KHEDLRIAKCHHIGSYQLPEIATVYDDHLK 241 >01_06_0042 - 25911662-25911736,25912409-25912607,25913275-25913348, 25913431-25913580,25913666-25913821,25915378-25915464, 25915706-25915765,25915878-25916414,25917292-25917585 Length = 543 Score = 27.9 bits (59), Expect = 7.8 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +3 Query: 372 PVAPHYLQETLKHEPKYVLEAAKFEPKYEIEPYYTG 479 P+A H L+ L +PK AA+ K +PY+TG Sbjct: 356 PMALHLLERLLAFDPKDRPTAAELCVKALTDPYFTG 391 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,778,798 Number of Sequences: 37544 Number of extensions: 329919 Number of successful extensions: 897 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 860 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 893 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1714968940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -