BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11o07 (287 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 1.7 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 23 2.3 AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 22 5.2 DQ974172-1|ABJ52812.1| 409|Anopheles gambiae serpin 13 protein. 21 6.9 AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. 21 6.9 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 21 6.9 CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein... 21 9.1 AY062197-1|AAL58558.1| 150|Anopheles gambiae cytochrome P450 CY... 21 9.1 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.4 bits (48), Expect = 1.7 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -2 Query: 238 FFIRDTNAFTMAAIDLYHL 182 ++IRD N F + ID+ +L Sbjct: 2575 YYIRDANGFVLMDIDMAYL 2593 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.0 bits (47), Expect = 2.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 92 RHPARSFLQHFGSLH 136 +H AR +QH GS+H Sbjct: 36 QHHARPAIQHVGSIH 50 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 21.8 bits (44), Expect = 5.2 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -3 Query: 138 IWRLPKCWRKLRAGCR 91 IWR+ WR A C+ Sbjct: 285 IWRITVVWRAGNAACK 300 >DQ974172-1|ABJ52812.1| 409|Anopheles gambiae serpin 13 protein. Length = 409 Score = 21.4 bits (43), Expect = 6.9 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +3 Query: 15 KNLNTKLIHNFNNLIQFKTSNLKMITDIQLAVFS 116 +NL + NFN L TSNL + +Q F+ Sbjct: 282 QNLFEPNVANFNGLQDSSTSNLYLSEILQTDSFA 315 >AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. Length = 437 Score = 21.4 bits (43), Expect = 6.9 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 77 SKNDHRHP 100 SK DHRHP Sbjct: 316 SKTDHRHP 323 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 92 RHPARSFLQHFGSLHIL 142 +H A +QH GS+H L Sbjct: 36 QHHAAPAIQHVGSVHAL 52 >CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein protein. Length = 415 Score = 21.0 bits (42), Expect = 9.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 74 QSKNDHRHPARSFLQHFGSLHILISYPVS 160 Q+ +DHR+ R L+ S + S PVS Sbjct: 79 QNVHDHRYALRLLLETQKSEDVESSIPVS 107 >AY062197-1|AAL58558.1| 150|Anopheles gambiae cytochrome P450 CYP4C27 protein. Length = 150 Score = 21.0 bits (42), Expect = 9.1 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 67 LN*IKLLKLCISFVLRFF 14 LN +KLL+ CI LR + Sbjct: 55 LNELKLLERCIKEALRLY 72 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 273,947 Number of Sequences: 2352 Number of extensions: 4483 Number of successful extensions: 10 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 55 effective length of database: 434,619 effective search space used: 17384760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -