BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11o05 (434 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g36240.1 68414.m04505 60S ribosomal protein L30 (RPL30A) simi... 173 6e-44 At3g18740.1 68416.m02379 60S ribosomal protein L30 (RPL30C) simi... 172 7e-44 At1g77940.1 68414.m09083 60S ribosomal protein L30 (RPL30B) simi... 170 3e-43 At3g02300.1 68416.m00212 regulator of chromosome condensation (R... 28 2.4 At3g26618.1 68416.m03325 eukaryotic release factor 1 family prot... 28 3.1 At1g12920.1 68414.m01500 eukaryotic release factor 1 family prot... 27 4.1 At4g18820.1 68417.m02778 expressed protein 27 5.5 At3g15130.1 68416.m01914 pentatricopeptide (PPR) repeat-containi... 26 9.5 >At1g36240.1 68414.m04505 60S ribosomal protein L30 (RPL30A) similar to GI:6984132 from [Euphorbia esula] Length = 112 Score = 173 bits (420), Expect = 6e-44 Identities = 79/109 (72%), Positives = 92/109 (84%) Frame = +3 Query: 60 MVAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLKTLRQGKAKLVIIAKNAPPLRKSEI 239 MVAAKK KK+ E INSRLALVMKSGKY LGYK LK+LR K KL++I+ N PPLR+SEI Sbjct: 1 MVAAKKTKKSHEGINSRLALVMKSGKYTLGYKSVLKSLRSSKGKLILISSNCPPLRRSEI 60 Query: 240 EYYALLAKTGVHHYSGNNIELGTACGKYYRVCTLAITDPGDSDIITTLP 386 EYYA+LAK GVHHY+ NN++LGTACGKY+RV L+I DPGDSDII +LP Sbjct: 61 EYYAMLAKVGVHHYNRNNVDLGTACGKYFRVSCLSIVDPGDSDIIKSLP 109 >At3g18740.1 68416.m02379 60S ribosomal protein L30 (RPL30C) similar to 60S RIBOSOMAL PROTEIN L30 GB:O49884 from [Lupinus luteus] Length = 112 Score = 172 bits (419), Expect = 7e-44 Identities = 79/109 (72%), Positives = 91/109 (83%) Frame = +3 Query: 60 MVAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLKTLRQGKAKLVIIAKNAPPLRKSEI 239 MVA KK KK+ E INSRLALVMKSGKY LGYK LK+LR K KL++I+ N PPLR+SEI Sbjct: 1 MVAEKKAKKSHEGINSRLALVMKSGKYTLGYKSVLKSLRSSKGKLILISSNCPPLRRSEI 60 Query: 240 EYYALLAKTGVHHYSGNNIELGTACGKYYRVCTLAITDPGDSDIITTLP 386 EYYA+LAK GVH Y+GNN++LGTACGKY+RV L+I DPGDSDII TLP Sbjct: 61 EYYAMLAKVGVHRYNGNNVDLGTACGKYFRVSCLSIVDPGDSDIIKTLP 109 >At1g77940.1 68414.m09083 60S ribosomal protein L30 (RPL30B) similar to ribosomal protein L30 GI:388034 from [Homo sapiens] Length = 112 Score = 170 bits (414), Expect = 3e-43 Identities = 77/109 (70%), Positives = 91/109 (83%) Frame = +3 Query: 60 MVAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLKTLRQGKAKLVIIAKNAPPLRKSEI 239 MV KK KK+ E INSRLALVMKSGKY LGYK LK+LR K KL++I+ N PPLR+SEI Sbjct: 1 MVTEKKTKKSHEGINSRLALVMKSGKYTLGYKSVLKSLRGSKGKLILISTNCPPLRRSEI 60 Query: 240 EYYALLAKTGVHHYSGNNIELGTACGKYYRVCTLAITDPGDSDIITTLP 386 EYYA+LAK GVHHY+GNN++LGTACGKY+RV L+I DPGDSDII ++P Sbjct: 61 EYYAMLAKVGVHHYNGNNVDLGTACGKYFRVSCLSIVDPGDSDIIKSIP 109 >At3g02300.1 68416.m00212 regulator of chromosome condensation (RCC1) family protein weak similarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 471 Score = 28.3 bits (60), Expect = 2.4 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +3 Query: 90 IESINSRLALVMKSGKYCLGYKQTLKTLRQGKAKLVIIAKNAPP 221 I + +++ KS Y GY Q+ +T R + KL+ I K PP Sbjct: 7 IGEVAPSVSIPTKSAIYVWGYNQSGQTGRNEQEKLLRIPKQLPP 50 >At3g26618.1 68416.m03325 eukaryotic release factor 1 family protein / eRF1 family protein contains Pfam profiles: PF03463 eRF1 domain 1, PF03464 eRF1 domain 2, PF03465 eRF1 domain 3 Length = 435 Score = 27.9 bits (59), Expect = 3.1 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 129 SGKYCLGYKQTLKTLRQGKAKLVIIAKN 212 +GKY G + TLK L G + +I+ +N Sbjct: 298 TGKYVFGVEDTLKALEMGAVETLIVWEN 325 >At1g12920.1 68414.m01500 eukaryotic release factor 1 family protein / eRF1 family protein contains Pfam profiles: PF03463 eRF1 domain 1, PF03464 eRF1 domain 2, PF03465 eRF1 domain 3 Length = 434 Score = 27.5 bits (58), Expect = 4.1 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 129 SGKYCLGYKQTLKTLRQGKAKLVIIAKN 212 +GKY G + TLK L G + +I+ +N Sbjct: 297 TGKYVFGVEDTLKALEMGAIETLIVWEN 324 >At4g18820.1 68417.m02778 expressed protein Length = 1111 Score = 27.1 bits (57), Expect = 5.5 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -1 Query: 362 VTRVCDGECAHSVVFSACCS*FNVVPAVVVNTC 264 +++V D VVF CS +V+P V+++ C Sbjct: 565 LSKVVDRAAPRHVVFILVCSSLDVLPHVIISRC 597 >At3g15130.1 68416.m01914 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 689 Score = 26.2 bits (55), Expect = 9.5 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 4/31 (12%) Frame = +2 Query: 119 GDEIGKILLRIQ----ANFENSSTRQSKAGY 199 G E+GKILLRI AN+ S +AGY Sbjct: 501 GKEVGKILLRIDAKNPANYVMMSNLYGQAGY 531 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,375,319 Number of Sequences: 28952 Number of extensions: 178085 Number of successful extensions: 445 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 441 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 445 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 683042040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -