BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11o03 (427 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 23 1.2 AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory recept... 23 1.2 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 21 6.6 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 23.0 bits (47), Expect = 1.2 Identities = 7/25 (28%), Positives = 13/25 (52%) Frame = +2 Query: 14 ENKQVTLKNNSHFHPFQYHEEIRIP 88 +N ++ L+N H F + + IP Sbjct: 195 DNNEILLRNGEKHHSFPFRKTTEIP 219 >AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory receptor candidate 20 protein. Length = 393 Score = 23.0 bits (47), Expect = 1.2 Identities = 14/61 (22%), Positives = 26/61 (42%), Gaps = 1/61 (1%) Frame = -1 Query: 298 NIT*ILLYIIFSEEPSDKSSCSAAALDACICGRTYLKYL*K*SV-SRTVPYNVNPMQTNT 122 N+T I ++ + +C +++ CICG + L S+ T N P++ Sbjct: 20 NLTKIFGFLPVCSSQKGQKTCLNLSINYCICGYIFSAILFSLSILGLTEDLNSAPIRMKN 79 Query: 121 P 119 P Sbjct: 80 P 80 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 20.6 bits (41), Expect = 6.6 Identities = 15/60 (25%), Positives = 27/60 (45%) Frame = +3 Query: 105 KLHKGGVLVCIGLTLYGTVLLTDHFYKYFKYVRPQIQASKAAAEQELLSEGSSEKIM*RR 284 ++HK +C Y T+ +T+ + + RP A+ A ELL S ++ R+ Sbjct: 296 QVHKQ-TAICFKAPRYHTLDITEPVKVFIQLRRPSDGATSEALPFELLPLDSEPGMLKRK 354 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,140 Number of Sequences: 336 Number of extensions: 2000 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 9490410 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -