BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10g22 (639 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25877| Best HMM Match : TP1 (HMM E-Value=8.5) 31 1.0 SB_44509| Best HMM Match : EMI (HMM E-Value=4.2) 30 1.4 SB_12493| Best HMM Match : RrnaAD (HMM E-Value=4.6) 30 1.4 SB_50241| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_51986| Best HMM Match : HLH (HMM E-Value=0.15) 29 2.4 SB_3213| Best HMM Match : zf-C2H2 (HMM E-Value=3.8e-40) 29 4.2 SB_47960| Best HMM Match : Extensin_2 (HMM E-Value=0.54) 29 4.2 SB_38410| Best HMM Match : 7tm_1 (HMM E-Value=0) 29 4.2 SB_22629| Best HMM Match : CDC37 (HMM E-Value=3.7) 28 5.6 SB_57364| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_38222| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_6135| Best HMM Match : CSD (HMM E-Value=5.4) 28 5.6 SB_13705| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_48322| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_43400| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_41377| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_15839| Best HMM Match : CDO_I (HMM E-Value=6.6) 27 9.7 SB_35716| Best HMM Match : PC4 (HMM E-Value=1.1e-12) 27 9.7 SB_31237| Best HMM Match : Cathelicidins (HMM E-Value=0.58) 27 9.7 SB_14072| Best HMM Match : ELO (HMM E-Value=5.7) 27 9.7 >SB_25877| Best HMM Match : TP1 (HMM E-Value=8.5) Length = 139 Score = 30.7 bits (66), Expect = 1.0 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +1 Query: 328 MPVMQDERKMSKRKKKVINNNKYILFNSWYTKIK 429 +PV +++ + K NN KY L WY+K++ Sbjct: 7 LPVQNQAKRLRTWRSKTRNNTKYKLICIWYSKVR 40 >SB_44509| Best HMM Match : EMI (HMM E-Value=4.2) Length = 782 Score = 30.3 bits (65), Expect = 1.4 Identities = 17/63 (26%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Frame = +2 Query: 35 DKCSKRK-VCLHHKRIARLLGIKKIYHQEYKRVVSKVYKNQTW*TCRSNNLLQKLRPCAK 211 D+ S RK C + +++ I+++ Q+ R +K+ K+ + TC +LR CA Sbjct: 63 DRYSTRKGACAVVQSSQKMIDIRRVRRQKSMRSCAKLSKDNRYSTCTPAEEYAQLRVCAV 122 Query: 212 MKS 220 ++S Sbjct: 123 VRS 125 >SB_12493| Best HMM Match : RrnaAD (HMM E-Value=4.6) Length = 984 Score = 30.3 bits (65), Expect = 1.4 Identities = 17/63 (26%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Frame = +2 Query: 35 DKCSKRK-VCLHHKRIARLLGIKKIYHQEYKRVVSKVYKNQTW*TCRSNNLLQKLRPCAK 211 D+ S RK C + +++ I+++ Q+ R +K+ K+ + TC +LR CA Sbjct: 830 DRYSTRKGACAVVQSSQKMIDIRRVRRQKSMRSCAKLSKDNRYSTCTPAEEYAQLRVCAV 889 Query: 212 MKS 220 ++S Sbjct: 890 VRS 892 >SB_50241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.5 bits (63), Expect = 2.4 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 3/60 (5%) Frame = +1 Query: 292 LEKKNINYILNVMPVMQDERKMSKRKKKVINNNKY---ILFNSWYTKIKQPEWPSSPAMW 462 +E K + Y V +DE K+ RK+ + +Y ILFN++ ++ +W S + W Sbjct: 26 IEAKTMKYKYGCSDVPRDE-KLDLRKRSLYYLERYFYFILFNTYLNMERRSKWDRSFSQW 84 >SB_51986| Best HMM Match : HLH (HMM E-Value=0.15) Length = 2110 Score = 29.5 bits (63), Expect = 2.4 Identities = 19/66 (28%), Positives = 36/66 (54%) Frame = +1 Query: 178 QSSTETAAVCKNEKLLNKLESSSYNKSNMDQLIAIVNFLEKKNINYILNVMPVMQDERKM 357 + S+E + C ++++E N ++ ++V+F+++ NI L P+ QDE + Sbjct: 191 EKSSEISLECPEILNVDEIEDEPIN-----EISSLVDFVDE-NIEKSLLKDPLWQDEEEK 244 Query: 358 SKRKKK 375 KRKKK Sbjct: 245 GKRKKK 250 >SB_3213| Best HMM Match : zf-C2H2 (HMM E-Value=3.8e-40) Length = 595 Score = 28.7 bits (61), Expect = 4.2 Identities = 19/70 (27%), Positives = 35/70 (50%) Frame = +1 Query: 112 SRIQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSSYNKSNMDQLIAIVNF 291 S Q G KG ++ + S T + KN + ESS++ +S D L+A ++ Sbjct: 343 SHEQHGELKGSGETVFYSPRAHASDTPSKKPTKNLTM----ESSTFKESEKDVLMASLDI 398 Query: 292 LEKKNINYIL 321 +KK++N ++ Sbjct: 399 KDKKHVNTLV 408 >SB_47960| Best HMM Match : Extensin_2 (HMM E-Value=0.54) Length = 710 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -1 Query: 240 RFQFIQQLFIFAHGRSFCRRLLLRHVYH 157 RF Q I+AH SF +R+LLR + H Sbjct: 22 RFPRNPQKLIYAHQNSFKKRILLRRIEH 49 >SB_38410| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 368 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = -1 Query: 414 PTVKQNVFIVVNHLLLAFGHFAFVLHDRHYVEDIVNVLF 298 P N+ +++ +L A + + HDR + E N+LF Sbjct: 313 PREVHNILLLMGYLNSALNPYMYSFHDRQFKEAFKNILF 351 >SB_22629| Best HMM Match : CDC37 (HMM E-Value=3.7) Length = 504 Score = 28.3 bits (60), Expect = 5.6 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -1 Query: 531 THLFSVIKNEHKICQFGRVFHQIPHGRATRPLGLLDLSVPT 409 TH SV+K K+C+ RV +Q H R R ++VPT Sbjct: 395 THWRSVVKKGAKLCEDKRV-NQAKHKRHLRKTRAASVTVPT 434 >SB_57364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 318 Score = 28.3 bits (60), Expect = 5.6 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -1 Query: 531 THLFSVIKNEHKICQFGRVFHQIPHGRATRPLGLLDLSVPT 409 TH SV+K K+C+ RV +Q H R R ++VPT Sbjct: 240 THWRSVVKKGAKLCEDKRV-NQAKHKRHLRKTRAASVTVPT 279 >SB_38222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 356 Score = 28.3 bits (60), Expect = 5.6 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -1 Query: 531 THLFSVIKNEHKICQFGRVFHQIPHGRATRPLGLLDLSVPT 409 TH SV+K K+C+ RV +Q H R R ++VPT Sbjct: 289 THWRSVVKKGAKLCEDKRV-NQAKHKRHLRKTRAASVTVPT 328 >SB_6135| Best HMM Match : CSD (HMM E-Value=5.4) Length = 254 Score = 28.3 bits (60), Expect = 5.6 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -1 Query: 531 THLFSVIKNEHKICQFGRVFHQIPHGRATRPLGLLDLSVPT 409 TH SV+K K+C+ RV +Q H R R ++VPT Sbjct: 198 THWRSVVKKGAKLCEDKRV-NQAKHKRHLRKTRAASVTVPT 237 >SB_13705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 781 Score = 27.9 bits (59), Expect = 7.4 Identities = 19/73 (26%), Positives = 34/73 (46%), Gaps = 3/73 (4%) Frame = +1 Query: 166 MPEQQSSTETAAVCKNEKLLNKLESSS---YNKSNMDQLIAIVNFLEKKNINYILNVMPV 336 +P S + T K EKL +K + S NK++M +N K+I + ++ Sbjct: 576 LPAYGSKSNTIKAFK-EKLFSKKSTDSTKAVNKTSMSPNFVYLNSCYSKSIEVLPSIYAT 634 Query: 337 MQDERKMSKRKKK 375 + E+K R++K Sbjct: 635 VDKEKKKRDRERK 647 >SB_48322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = -1 Query: 432 LLDLSVPTVKQNVFIVVNHLLLAFGHFAFVLHDRHYVEDIVNVLF 298 L+ ++ T+K N NH+L F H F + + +E+ V+ F Sbjct: 102 LILTTLRTIKGNFMFFENHILAKFLHGKFFIGNPETIEESVDATF 146 >SB_43400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 306 H*LYPQRNACHAGRTQNVQTQEE 374 H LYP RNA GR+ + T EE Sbjct: 92 HRLYPDRNAVKLGRSITLHTYEE 114 >SB_41377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 331 Score = 27.5 bits (58), Expect = 9.7 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = +3 Query: 108 IIKNTSG-SFQRFTKIKHGKHAGATIFYRNCGRVQK*KVVE*TGIELLQQIQHGPAN 275 I+K+T G F R K K + RNC +++ K +E + ++L +I GP + Sbjct: 148 IVKHTKGVCFSRRAKDSVKKES------RNCSSIEERKAIENSTVDLCPEISRGPCS 198 >SB_15839| Best HMM Match : CDO_I (HMM E-Value=6.6) Length = 313 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 306 H*LYPQRNACHAGRTQNVQTQEE 374 H LYP RNA GR+ + T EE Sbjct: 92 HRLYPDRNAVKLGRSITLHTYEE 114 >SB_35716| Best HMM Match : PC4 (HMM E-Value=1.1e-12) Length = 501 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/46 (26%), Positives = 20/46 (43%) Frame = +1 Query: 172 EQQSSTETAAVCKNEKLLNKLESSSYNKSNMDQLIAIVNFLEKKNI 309 + Q S +A K K + + N+D + ++ F E KNI Sbjct: 162 QNQGSKSSAISNKKSKQQKVTQDKESQRKNLDSCVVVIRFNEDKNI 207 >SB_31237| Best HMM Match : Cathelicidins (HMM E-Value=0.58) Length = 562 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +1 Query: 295 EKKNINYILNVMPVMQDERK 354 EK N N ILN +P+ Q+++K Sbjct: 248 EKDNSNTILNTLPIKQEQKK 267 >SB_14072| Best HMM Match : ELO (HMM E-Value=5.7) Length = 226 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = -1 Query: 396 VFIVVNHLLLAFGHFAFVLHDRHYVEDIVNVLFFQEIYNS 277 V ++ N L ++FV+ +HYV++ V LF E+ S Sbjct: 108 VLVLYNLLCSVLSLYSFVIIAKHYVQNGVESLFRMEVNQS 147 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,745,777 Number of Sequences: 59808 Number of extensions: 453478 Number of successful extensions: 1112 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 1066 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1111 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1608851125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -