BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10g23 (735 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 26 0.36 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 26 0.36 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 24 1.5 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 23 1.9 AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 23 3.4 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 23 3.4 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 23 3.4 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 25.8 bits (54), Expect = 0.36 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +2 Query: 443 QLFIEHSEALEINQKLQDT--INTFSQCSDEFCDSLKITAE 559 QLF+EH E IN++ DT + T + ++ C +K+T + Sbjct: 234 QLFLEHYEV--INRQTLDTADVKTLTTVVEKECYKMKVTID 272 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 25.8 bits (54), Expect = 0.36 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +2 Query: 443 QLFIEHSEALEINQKLQDT--INTFSQCSDEFCDSLKITAE 559 QLF+EH E IN++ DT + T + ++ C +K+T + Sbjct: 160 QLFLEHYEV--INRQTLDTADVKTLTTVVEKECYKMKVTID 198 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 566 HKLAEADDCISDLRSELCKLKEQQP 640 HKLAEA D ++ + L+E+ P Sbjct: 564 HKLAEASDKDPEMYDRVVALREKNP 588 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 23.4 bits (48), Expect = 1.9 Identities = 17/61 (27%), Positives = 31/61 (50%) Frame = +2 Query: 491 QDTINTFSQCSDEFCDSLKITAELRHKLAEADDCISDLRSELCKLKEQQPQSLYSELVQS 670 Q+T+ + Q + DSLK E+ KL D +S L ++ ++ + ++ Y E V+ Sbjct: 353 QETLKSQVQRESDVVDSLKDVIEIVDKLLNPDLGLSLL--QVAQIFKNLLENHYEEFVRY 410 Query: 671 E 673 E Sbjct: 411 E 411 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = +3 Query: 609 QSYVNLRNSSLRAYIRNWFRAN 674 +SY+ ++S+R+++ NW AN Sbjct: 197 RSYIPPLSTSMRSHLCNWGSAN 218 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = +3 Query: 609 QSYVNLRNSSLRAYIRNWFRAN 674 +SY+ ++S+R+++ NW AN Sbjct: 357 RSYIPPLSTSMRSHLCNWGSAN 378 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = +3 Query: 609 QSYVNLRNSSLRAYIRNWFRAN 674 +SY+ ++S+R+++ NW AN Sbjct: 357 RSYIPPLSTSMRSHLCNWGSAN 378 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,108 Number of Sequences: 336 Number of extensions: 2569 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19675845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -