BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10g19 (685 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock p... 116 9e-28 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 27 0.55 AY748839-1|AAV28187.1| 169|Anopheles gambiae cytochrome P450 pr... 25 1.7 AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprol... 24 3.9 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 24 3.9 >AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock protein protein. Length = 133 Score = 116 bits (278), Expect = 9e-28 Identities = 57/126 (45%), Positives = 75/126 (59%) Frame = +1 Query: 265 DVGSSIKVDKDKFQVNLDVQHFAPEEISVKTADGYIVVXXXXXXXXXXXXYISRQFVRRY 444 D GS++ + KDKFQ+NLDVQ F+PEEISVK D ++V Y+SR FVRRY Sbjct: 3 DSGSAVNISKDKFQINLDVQQFSPEEISVKYVDNCVLVEGKHEEKQDDHGYVSRHFVRRY 62 Query: 445 ALPEGAAPETVESRLSSDGVLTITAPRKVPDAVKGERKVPIAQTGPVRKEIKDQSEEANE 624 LP+G + S LSSDG+LTIT PRK + ER +PI TG K++ ++ N Sbjct: 63 MLPKGHNEADIVSSLSSDGILTITCPRKEIEQKNEERSIPITHTGQPMKQVTGKAAPENG 122 Query: 625 KEK*KG 642 K +G Sbjct: 123 HSKKEG 128 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 27.1 bits (57), Expect = 0.55 Identities = 15/49 (30%), Positives = 19/49 (38%) Frame = +2 Query: 473 LWNRDCHQTGYSPSLRRGRCLTPSRERERCPSHRPVPFARRSRIRVKKP 619 LW ++C SP R ++P S P P RS KKP Sbjct: 341 LWMKNCKSCSISPVSDRSESVSPVPSLPVRSSPEPSPVLLRSPTPAKKP 389 >AY748839-1|AAV28187.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 25.4 bits (53), Expect = 1.7 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 133 RPRRLLDQHFGLALTPDDLLSVAAGPLL 216 RP R LD+H LAL D + AG L Sbjct: 114 RPERFLDEHGRLALAKDLSVPFGAGKRL 141 >AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprolinase protein. Length = 756 Score = 24.2 bits (50), Expect = 3.9 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 91 MSLLPYFFDDFGSRRPRRLLDQHFGLALTPDDLL 192 +S+ P + D + RR+L Q G ALT D L+ Sbjct: 34 LSVDPANYPDAPTEGIRRILQQETGRALTVDGLI 67 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 24.2 bits (50), Expect = 3.9 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 91 MSLLPYFFDDFGSRRPRRLLDQHFGLALTPDDLL 192 +S+ P + D + RR+L Q G ALT D L+ Sbjct: 34 LSVDPANYPDAPTEGIRRILQQETGRALTVDGLI 67 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 689,926 Number of Sequences: 2352 Number of extensions: 13840 Number of successful extensions: 18 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -