BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10g17 (453 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26440.1 68415.m03172 pectinesterase family protein contains ... 27 4.5 At1g72270.1 68414.m08355 expressed protein 27 5.9 >At2g26440.1 68415.m03172 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 547 Score = 27.5 bits (58), Expect = 4.5 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +2 Query: 185 IIFGAGVYTGVYVAQNYQIEKVEDPKALFEKAQAFVKSKLSEVQDGKKD 331 ++ GAGV + Q ++ D K L +F+K +S++QDG D Sbjct: 87 LLSGAGVSNNLVEGQRGSLQ---DCKDLHHITSSFLKRSISKIQDGVND 132 >At1g72270.1 68414.m08355 expressed protein Length = 2777 Score = 27.1 bits (57), Expect = 5.9 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +2 Query: 215 VYVAQNYQIEKVEDPKALFEKAQAFVKSKLSEVQDGKKD 331 VY + Y ++ DP+ L V+S LSEV DG KD Sbjct: 1090 VYSSLKYILQTQVDPRPL----SCLVQSVLSEVVDGSKD 1124 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,082,477 Number of Sequences: 28952 Number of extensions: 106865 Number of successful extensions: 187 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 187 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 187 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 742437000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -