BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10g15 (643 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 24 4.7 AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CY... 23 6.2 AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CY... 23 6.2 AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CY... 23 6.2 AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CY... 23 6.2 AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CY... 23 6.2 AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CY... 23 6.2 AY330177-1|AAQ16283.1| 166|Anopheles gambiae odorant-binding pr... 23 6.2 AY146749-1|AAO12064.1| 336|Anopheles gambiae odorant-binding pr... 23 6.2 AJ618926-1|CAF02005.1| 315|Anopheles gambiae odorant-binding pr... 23 6.2 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 23 6.2 AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. 23 8.2 AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-tran... 23 8.2 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 23 8.2 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 23 8.2 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 23.8 bits (49), Expect = 4.7 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +3 Query: 408 QQRSYWFGCEVQQGSRHCHSRR 473 ++R+YW+ E+ Q HC R Sbjct: 268 RRRAYWWTTEIAQCRSHCIEAR 289 >AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.4 bits (48), Expect = 6.2 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 351 LYRHDLKNLIIQGRAEE 301 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.4 bits (48), Expect = 6.2 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 351 LYRHDLKNLIIQGRAEE 301 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.4 bits (48), Expect = 6.2 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 351 LYRHDLKNLIIQGRAEE 301 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.4 bits (48), Expect = 6.2 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 351 LYRHDLKNLIIQGRAEE 301 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.4 bits (48), Expect = 6.2 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 351 LYRHDLKNLIIQGRAEE 301 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.4 bits (48), Expect = 6.2 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 351 LYRHDLKNLIIQGRAEE 301 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY330177-1|AAQ16283.1| 166|Anopheles gambiae odorant-binding protein AgamOBP50 protein. Length = 166 Score = 23.4 bits (48), Expect = 6.2 Identities = 12/44 (27%), Positives = 19/44 (43%) Frame = -3 Query: 623 IPVPRGAGISRTVTEPHLPVTLQGTVCGFPILLPQ*PLRTGRTD 492 + +P +T+ E + QGTVC F + + TG D Sbjct: 35 LTLPTYGNCLQTIAEKYPDALWQGTVCAFDCTYREMGILTGVDD 78 >AY146749-1|AAO12064.1| 336|Anopheles gambiae odorant-binding protein AgamOBP38 protein. Length = 336 Score = 23.4 bits (48), Expect = 6.2 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +3 Query: 591 PADSCPSWYWYCVCAS 638 PADSC YW C S Sbjct: 118 PADSCAGAYWSFRCYS 133 >AJ618926-1|CAF02005.1| 315|Anopheles gambiae odorant-binding protein OBPjj6b protein. Length = 315 Score = 23.4 bits (48), Expect = 6.2 Identities = 12/44 (27%), Positives = 19/44 (43%) Frame = -3 Query: 623 IPVPRGAGISRTVTEPHLPVTLQGTVCGFPILLPQ*PLRTGRTD 492 + +P +T+ E + QGTVC F + + TG D Sbjct: 184 LTLPTYGNCLQTIAEKYPDALWQGTVCAFDCTYREMGILTGVDD 227 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 23.4 bits (48), Expect = 6.2 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 351 LYRHDLKNLIIQGRAEE 301 + RHD+ NL++Q R +E Sbjct: 275 IVRHDMINLLMQARKQE 291 >AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. Length = 304 Score = 23.0 bits (47), Expect = 8.2 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = -1 Query: 139 RVHEDRHGLYLHRVIRIRRENRHVHRLEQRPPLLNDG 29 RVH H H + + R + +Q+P L+ DG Sbjct: 84 RVHIFEHAANHHHLAHLARVGLYGSSRKQKPVLMMDG 120 >AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-transferase e8 protein. Length = 217 Score = 23.0 bits (47), Expect = 8.2 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 280 EFEIIDFFLGPSLNDEVLKIMPV 348 + E ID F G L+ + LKI P+ Sbjct: 29 KLEYIDLFKGGHLSSDYLKINPL 51 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.0 bits (47), Expect = 8.2 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +3 Query: 588 SPADSCPSWYWYC 626 +P SCP YW C Sbjct: 879 TPVMSCPQDYWLC 891 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.0 bits (47), Expect = 8.2 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +3 Query: 588 SPADSCPSWYWYC 626 +P SCP YW C Sbjct: 879 TPVMSCPQDYWLC 891 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 679,259 Number of Sequences: 2352 Number of extensions: 14007 Number of successful extensions: 44 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63141405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -