BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10g09 (661 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 32 0.36 SB_33033| Best HMM Match : G-patch (HMM E-Value=0.71) 29 3.4 SB_32922| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 32.3 bits (70), Expect = 0.36 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -3 Query: 569 QEIAASNTSPRR*VVLRRRCTPRPHIAPVPRSLQPDP 459 QE++ S +R +LR C H+ P+P S +P P Sbjct: 458 QEVSFSQRFQKRGSILRELCIHAKHVQPIPASTRPPP 494 >SB_33033| Best HMM Match : G-patch (HMM E-Value=0.71) Length = 696 Score = 29.1 bits (62), Expect = 3.4 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 5/44 (11%) Frame = +3 Query: 432 YVRER*STGWVWLKTTRNRC-----DMWAWRASSPEHYSSARRC 548 YV+E +T VWLKT+ N C W+ + ++P+++ R+C Sbjct: 417 YVQE--TTYAVWLKTSANSCMRGRPCSWSHKRTTPKNHRDERKC 458 >SB_32922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 489 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = +3 Query: 522 EHYSSARRCVAGCNLLLGSRKTNGLRLIHIRSTI 623 +H S + + GC+LL ++ N L +H+R+ + Sbjct: 341 DHSQSCQELIRGCDLLERQQRKNTLLTLHVRALV 374 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,643,155 Number of Sequences: 59808 Number of extensions: 405231 Number of successful extensions: 872 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 817 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 872 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -