BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10g09 (661 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g19850.1 68417.m02909 lectin-related low similarity to PP2 le... 28 6.3 >At4g19850.1 68417.m02909 lectin-related low similarity to PP2 lectin polypeptide [Cucurbita maxima] GI:410437 Length = 194 Score = 27.9 bits (59), Expect = 6.3 Identities = 16/60 (26%), Positives = 32/60 (53%), Gaps = 6/60 (10%) Frame = +3 Query: 45 LRLRKRNSLTICSRDVAALPYIPTRAVNFIDGSIF------YIFILCNFLVIVDFCFYYI 206 +R+++R +++ C+R+++ L + +N GS+ Y F C + V FCF+ I Sbjct: 1 MRVKRRKTVSCCTREISQLHGQSLKQINIGVGSLILTKHQGYEF-YCKKVTFVFFCFFKI 59 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,433,427 Number of Sequences: 28952 Number of extensions: 269062 Number of successful extensions: 619 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 601 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 619 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1383534864 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -