BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10g06 (318 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g06680.1 68416.m00788 60S ribosomal protein L29 (RPL29B) simi... 89 6e-19 At3g06700.1 68416.m00792 60S ribosomal protein L29 (RPL29A) simi... 89 8e-19 At1g04030.1 68414.m00390 expressed protein 32 0.072 At4g10220.1 68417.m01676 hypothetical protein IB1C3-1 protein, A... 32 0.096 At5g50350.1 68418.m06236 expressed protein 29 0.67 At3g48200.1 68416.m05259 expressed protein 27 2.7 At5g56560.1 68418.m07058 F-box family protein contains F-box dom... 27 3.6 At4g37950.1 68417.m05365 expressed protein 27 3.6 At4g01925.1 68417.m00256 DC1 domain-containing protein low simil... 26 4.8 At3g13760.1 68416.m01736 DC1 domain-containing protein contains ... 26 4.8 At1g62720.1 68414.m07079 pentatricopeptide (PPR) repeat-containi... 26 4.8 At3g25950.1 68416.m03234 hypothetical protein 26 6.3 At5g35550.1 68418.m04229 myb family transcription factor (MYB123... 25 8.3 At4g35940.1 68417.m05113 expressed protein 25 8.3 At3g17010.1 68416.m02172 transcriptional factor B3 family protei... 25 8.3 At1g65120.2 68414.m07382 ubiquitin carboxyl-terminal hydrolase-r... 25 8.3 At1g65120.1 68414.m07383 ubiquitin carboxyl-terminal hydrolase-r... 25 8.3 >At3g06680.1 68416.m00788 60S ribosomal protein L29 (RPL29B) similar to 60S ribosomal protein L29 GB:P25886 from (Rattus norvegicus) Length = 83 Score = 89.0 bits (211), Expect = 6e-19 Identities = 38/53 (71%), Positives = 45/53 (84%) Frame = +2 Query: 50 KMAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLK 208 +MAKSKNHT HNQ+ KAH+NGIKKPR+ RH T GMDPKFLRNQR+ +K N+K Sbjct: 22 EMAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARKHNVK 74 >At3g06700.1 68416.m00792 60S ribosomal protein L29 (RPL29A) similar to ribosomal protein L29 GI:7959366 [Panax ginseng] Length = 61 Score = 88.6 bits (210), Expect = 8e-19 Identities = 38/52 (73%), Positives = 44/52 (84%) Frame = +2 Query: 53 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLK 208 MAKSKNHT HNQ+ KAH+NGIKKPR+ RH T GMDPKFLRNQR+ +K N+K Sbjct: 1 MAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARKHNVK 52 >At1g04030.1 68414.m00390 expressed protein Length = 418 Score = 32.3 bits (70), Expect = 0.072 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +2 Query: 50 KMAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPK 166 K AKSK T Q++K + N I + R S+ G DP+ Sbjct: 215 KSAKSKGRTKQKQSQKENSNFIADQEEKRDSSSFGTDPQ 253 >At4g10220.1 68417.m01676 hypothetical protein IB1C3-1 protein, Arabidopsis thaliana, AJ011845 Length = 400 Score = 31.9 bits (69), Expect = 0.096 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 65 KNHTNHNQNRKAHRNGIKKPRKTRHESTLG 154 KNHT H++ R ++ G K RKT +T G Sbjct: 88 KNHTFHHKMRMSYSEGSKMKRKTHRNTTFG 117 >At5g50350.1 68418.m06236 expressed protein Length = 584 Score = 29.1 bits (62), Expect = 0.67 Identities = 26/93 (27%), Positives = 44/93 (47%), Gaps = 4/93 (4%) Frame = +3 Query: 3 RSSVLSSDSKWIENSSKWQSQRIIQIITKTAKLTEMVSKSQGRPGTNPPLAWIQNF*GI- 179 +SS ++ D +SSK ++RII+ + K T +S G G + + G+ Sbjct: 282 QSSAVTDDEGKDSSSSKHGTERIIRTVYAQNKATPKKRESLGNSGYGSQRKSLDDNRGVS 341 Query: 180 ---KGFARRVT*SQPSNSRGRLREKLPEKQRPR 269 KG+A ++ S+ R L E + E+QR R Sbjct: 342 TSTKGYATKLQESE-ERKRELLAEIMLEEQRGR 373 >At3g48200.1 68416.m05259 expressed protein Length = 1088 Score = 27.1 bits (57), Expect = 2.7 Identities = 17/55 (30%), Positives = 23/55 (41%) Frame = +2 Query: 47 IKMAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLKP 211 I +A S H+ K H N I T ES G+ + + F + NLKP Sbjct: 548 IMVATSPYIGPHSFISKTHNNMINLKTSTNAESVFGLPLTAMEYRLFFETSNLKP 602 >At5g56560.1 68418.m07058 F-box family protein contains F-box domain Pfam:PF00646 Length = 607 Score = 26.6 bits (56), Expect = 3.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -2 Query: 200 YPSCKTFDSLKILDPCQGWIRAWSSL 123 YP+C F SLK L+ C R W++L Sbjct: 475 YPACTVFSSLKYLELCTCSAR-WANL 499 >At4g37950.1 68417.m05365 expressed protein Length = 678 Score = 26.6 bits (56), Expect = 3.6 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +3 Query: 45 SSKWQSQ-RIIQIITKTAKLTEMVSKSQGRPGTNPPLAWIQNF*GIKGFARRVT 203 + WQ++ + Q T+ K+ M + + RPGT AW+ F G + R +T Sbjct: 408 AGSWQTENKGYQFWTRADKMG-MFTIANVRPGTYSLYAWVSGFIGDYKYVRDIT 460 >At4g01925.1 68417.m00256 DC1 domain-containing protein low similarity to UV-B light insensitive ULI3 [Arabidopsis thaliana] GI:17225050; contains Pfam profile PF03107: DC1 domain Length = 399 Score = 26.2 bits (55), Expect = 4.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 113 YHFCELCGFGYDLYDSLTLP 54 YH CE CGF DLY ++ P Sbjct: 65 YH-CETCGFDVDLYCAMYPP 83 >At3g13760.1 68416.m01736 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 652 Score = 26.2 bits (55), Expect = 4.8 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -2 Query: 113 YHFCELCGFGYDLYDSLTLPF**VFNP 33 ++ C +CGF DL +LTLP + NP Sbjct: 182 FYRCLICGFCLDLSCALTLPPLTIANP 208 >At1g62720.1 68414.m07079 pentatricopeptide (PPR) repeat-containing protein contains multiple PPR repeats Pfam Profile: PF01535 Length = 426 Score = 26.2 bits (55), Expect = 4.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -2 Query: 113 YHFCELCGFGYDLY 72 +H E+CG G+DLY Sbjct: 33 FHHMEVCGIGHDLY 46 >At3g25950.1 68416.m03234 hypothetical protein Length = 251 Score = 25.8 bits (54), Expect = 6.3 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 154 AKGGFVPGLPWLFDTISVSFAVLVMICMIL 65 A G VP WL + + FA+LV I +L Sbjct: 205 AADGVVPRWAWLSWLVVIGFAILVSILWVL 234 >At5g35550.1 68418.m04229 myb family transcription factor (MYB123) contains PFAM profile: myb DNA-binding domain PF00249 Length = 258 Score = 25.4 bits (53), Expect = 8.3 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = +2 Query: 65 KNHTNHNQNRKAHRNGIKKPRKTRHES 145 KNH N N ++ + K+P++ +H + Sbjct: 107 KNHWNSNLRKRLPKTQTKQPKRIKHST 133 >At4g35940.1 68417.m05113 expressed protein Length = 451 Score = 25.4 bits (53), Expect = 8.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 192 RRVT*SQPSNSRGRLREKLPEKQRP 266 +R+ QP N R +EK EKQ+P Sbjct: 230 KRIEKQQPLNGRHNNKEKQKEKQQP 254 >At3g17010.1 68416.m02172 transcriptional factor B3 family protein contains Pfam profile PF02362: B3 DNA binding domain Length = 302 Score = 25.4 bits (53), Expect = 8.3 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +2 Query: 59 KSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKF 169 K K + + +K RN +KK K++ + L P+F Sbjct: 166 KKKTEDSKSSKKKMTRNKVKKKSKSKSKQVLDGVPEF 202 >At1g65120.2 68414.m07382 ubiquitin carboxyl-terminal hydrolase-related contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF04780: Protein of unknown function (DUF629), PF04781: Protein of unknown function (DUF627) Length = 1147 Score = 25.4 bits (53), Expect = 8.3 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 65 KNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPK 166 K+ +N +NR R + HES++ ++PK Sbjct: 751 KSGSNKKKNRSNKRTSASMSKDDVHESSVNLEPK 784 >At1g65120.1 68414.m07383 ubiquitin carboxyl-terminal hydrolase-related contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF04780: Protein of unknown function (DUF629), PF04781: Protein of unknown function (DUF627) Length = 1121 Score = 25.4 bits (53), Expect = 8.3 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 65 KNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPK 166 K+ +N +NR R + HES++ ++PK Sbjct: 751 KSGSNKKKNRSNKRTSASMSKDDVHESSVNLEPK 784 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,661,111 Number of Sequences: 28952 Number of extensions: 124389 Number of successful extensions: 387 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 384 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 386 length of database: 12,070,560 effective HSP length: 71 effective length of database: 10,014,968 effective search space used: 340508912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -