BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10g03 (710 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_564| Best HMM Match : TrkA_N (HMM E-Value=0.05) 74 1e-13 SB_43953| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_5284| Best HMM Match : CHASE3 (HMM E-Value=0.83) 30 2.1 SB_56714| Best HMM Match : 7tm_3 (HMM E-Value=1.6e-18) 29 2.8 SB_52562| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_52454| Best HMM Match : 3HCDH_N (HMM E-Value=1.3) 29 4.9 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 29 4.9 SB_12316| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_56890| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 >SB_564| Best HMM Match : TrkA_N (HMM E-Value=0.05) Length = 226 Score = 74.1 bits (174), Expect = 1e-13 Identities = 59/209 (28%), Positives = 98/209 (46%), Gaps = 16/209 (7%) Frame = +1 Query: 112 KKVVIFGSTGVIGLNAVEAALKKGLEVRAFVRDPAKLPEHLKDKVEIVKGNVLEPDSVHE 291 KKVV+FG TG GL+ V+ AL +G V R P K+ D + +VKG++ + +S Sbjct: 8 KKVVVFGGTGKTGLHVVQQALDRGHHVTVIARSPEKMTIK-NDNLVVVKGDIFDIESFSP 66 Query: 292 AVEGTDAVVITLGT--RNDLAPTSDLSEGTKNIIDAMRAKNVKTV-------SACLSAFL 444 + EG DA++ T GT + PT++ SE K I+ M+ V + + Sbjct: 67 SFEGKDAILSTFGTAFHSIFNPTTEYSESMKGILQTMKKHGVNRLIVETSWGTEATPGGP 126 Query: 445 FYEQEKVPPIFVN-LNEDHKRMFQAL-KDSGLNWIAAFPPHFTDDPSR-----EMIIEVN 603 F + + P+ +N + +D M + K+ G+N+ P T+DP E + N Sbjct: 127 FSLEWIIKPLLLNGMLKDMGVMEHMIEKEEGINYTIVRPAGLTNDPPNGKYKIEEGVYCN 186 Query: 604 PEKTPGRTIAKCDLGTFLVDALSEPKYYK 690 T R I + D+ +++ L +Y K Sbjct: 187 KTGTTHR-IPRADVAACMLNCLDTDQYDK 214 >SB_43953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +1 Query: 556 PHFTDDPSREMIIEVNPEKTPGRTIAKCDLGTF 654 P FT P I V P +TPG CD+ F Sbjct: 188 PLFTSQPKHVQNILVRPSRTPGPAFYICDINAF 220 >SB_5284| Best HMM Match : CHASE3 (HMM E-Value=0.83) Length = 957 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +1 Query: 484 LNEDHKRMFQALKDSGLNWIAAFPPHFTDDPSREMIIEVNPEKTP 618 + E ++R+ + LKD G+ F P TD+ E ++EV E+ P Sbjct: 250 IQEKNERIKKILKDLGIEE-KVFEPTMTDEEVPERLLEVRDEEVP 293 >SB_56714| Best HMM Match : 7tm_3 (HMM E-Value=1.6e-18) Length = 484 Score = 29.5 bits (63), Expect = 2.8 Identities = 20/50 (40%), Positives = 25/50 (50%) Frame = +1 Query: 424 ACLSAFLFYEQEKVPPIFVNLNEDHKRMFQALKDSGLNWIAAFPPHFTDD 573 A LS F Y+ K+P N NE +F AL L+WI +P HF D Sbjct: 333 AGLSTFYAYKARKIPE---NFNEARGIVF-ALYILILSWIVYYPVHFALD 378 >SB_52562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1490 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = -1 Query: 329 PRVMTTASVPSTASCTESGSRTFPLT 252 PR +T+++V S+ S +++GS T PLT Sbjct: 1342 PRPITSSTVTSSMSSSDAGSSTTPLT 1367 >SB_52454| Best HMM Match : 3HCDH_N (HMM E-Value=1.3) Length = 114 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +1 Query: 106 EMKKVVIFGSTGVIGLNAVEAALKKGLEVRAF-VRDP 213 E KKVV+ G G G A +KG EV F +R+P Sbjct: 10 EGKKVVVTGGAGYFGSRLGYALSEKGAEVTLFDIREP 46 >SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) Length = 1290 Score = 28.7 bits (61), Expect = 4.9 Identities = 26/84 (30%), Positives = 36/84 (42%), Gaps = 3/84 (3%) Frame = -1 Query: 332 VPRVMTTASVPSTASCTESG--SRTFPLTISTLSLRCSGSFAGSRTNARTSRPFLSAAST 159 V R + S P+ AS S S P STL+ R G F+G+ + A T A+S Sbjct: 489 VTRKVAGKSSPANASVIASPEVSSPQPFGTSTLASRVIGPFSGALSGALTKTTLARASSP 548 Query: 158 AFKPI-TPVEPKITTFFISMNKKY 90 P+ V I T F M ++ Sbjct: 549 TPSPMRLGVHTSIDTSFQRMKLQW 572 >SB_12316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 676 Score = 27.9 bits (59), Expect = 8.6 Identities = 20/63 (31%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Frame = +1 Query: 220 LPEHLKDKVEIVKGNVLEPDSVHEAVEGTDAVVITLG-TRNDLAPTSDLSEGTKNIIDAM 396 L + L D E G + E VH+AVE + G + D+A + E K ID M Sbjct: 133 LDQELADANEAYVGKIEEFKEVHKAVEQLRTSGFSTGEIKKDIANMEEEHEQLKKRIDRM 192 Query: 397 RAK 405 + K Sbjct: 193 QKK 195 >SB_56890| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1665 Score = 27.9 bits (59), Expect = 8.6 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 208 DPAKLPEHLKDKVEIVKGNVLEPDSV 285 DPAK +KD + ++GN+L PD V Sbjct: 341 DPAKEQPGIKDNDDDIEGNLLLPDGV 366 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,782,798 Number of Sequences: 59808 Number of extensions: 425958 Number of successful extensions: 1191 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1052 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1183 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -