BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10f22 (590 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g80870.1 68414.m09489 protein kinase family protein contains ... 32 0.25 At5g18000.1 68418.m02111 transcriptional factor B3 family protei... 30 1.3 At3g53720.1 68416.m05934 cation/hydrogen exchanger, putative (CH... 28 5.4 At1g45160.1 68414.m05177 protein kinase family protein contains ... 27 9.4 >At1g80870.1 68414.m09489 protein kinase family protein contains eukaryotic protein kinase domain, INTERPRO:IPR000719 Length = 692 Score = 32.3 bits (70), Expect = 0.25 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Frame = +1 Query: 139 RKMMSMSSPLMEISIDGDTM--TIKNSSLLRTVEHKFKLGEEYEEKMPNSII 288 R + MS M +++DG+T + N +L +H+F G+E PNS++ Sbjct: 286 RNIKEMSLNSMSLAMDGETKGKEVSNDVVLSCEDHEFDQGKEMNLLSPNSVL 337 >At5g18000.1 68418.m02111 transcriptional factor B3 family protein contains Pfam profile PF02362: B3 DNA binding domain Length = 307 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +1 Query: 265 EKMPNSIIKSVTTITNDSEMETKSVIPD 348 EK S K V T++NDSE T S+IP+ Sbjct: 189 EKSKTSKKKKVETVSNDSEAGTSSLIPE 216 >At3g53720.1 68416.m05934 cation/hydrogen exchanger, putative (CHX20) monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 842 Score = 27.9 bits (59), Expect = 5.4 Identities = 13/50 (26%), Positives = 26/50 (52%) Frame = +1 Query: 178 SIDGDTMTIKNSSLLRTVEHKFKLGEEYEEKMPNSIIKSVTTITNDSEME 327 ++D + + L + K+K EY+EK PN+II+ + +I + + Sbjct: 715 NVDPEKEKELDEGALEDFKSKWKEMVEYKEKEPNNIIEEILSIGQSKDFD 764 >At1g45160.1 68414.m05177 protein kinase family protein contains eukaryotic protein kinase domain, INTERPRO:IPR000719 Length = 1067 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +1 Query: 223 RTVEHKFKLGEEYEEKMPN 279 + VE +F L +EYE+KM N Sbjct: 370 KVVEQRFYLSDEYEDKMSN 388 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,773,345 Number of Sequences: 28952 Number of extensions: 231676 Number of successful extensions: 450 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 445 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 450 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1171109464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -