BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10e20 (591 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15975| Best HMM Match : NHL (HMM E-Value=5e-09) 28 5.0 SB_17602| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 >SB_15975| Best HMM Match : NHL (HMM E-Value=5e-09) Length = 589 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 13 GNYDIVCNINSRITLVNYALGKYVGRYV 96 G+ +VC++NS+ + G++VGRYV Sbjct: 527 GDNILVCDVNSKSIQMYSTAGQFVGRYV 554 >SB_17602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 422 Score = 27.5 bits (58), Expect = 8.7 Identities = 18/64 (28%), Positives = 30/64 (46%) Frame = +1 Query: 64 YALGKYVGRYVSNFEQLYRLNVLKYVTILVXXXXXXXXFLCFLLMTELSILYIFTNYENV 243 Y +GK++GR F ++L Y+ + F+ F+L LS + F Y + Sbjct: 280 YNIGKFIGRSHIFFFACLLPSLLPYILVRQTWRLAILEFVHFVLFLSLS-WFRFIPYVSA 338 Query: 244 ILVL 255 +LVL Sbjct: 339 VLVL 342 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,316,688 Number of Sequences: 59808 Number of extensions: 244856 Number of successful extensions: 381 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 340 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 380 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1434459094 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -