BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10d07 (360 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40253| Best HMM Match : Spectrin (HMM E-Value=5.9e-16) 27 3.5 SB_15448| Best HMM Match : Utp11 (HMM E-Value=0.89) 27 3.5 SB_56776| Best HMM Match : CRA_rpt (HMM E-Value=5.6e-17) 27 6.1 SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.0 SB_27157| Best HMM Match : CLPTM1 (HMM E-Value=0) 26 8.0 SB_24384| Best HMM Match : I-set (HMM E-Value=4.3e-31) 26 8.0 SB_34017| Best HMM Match : Pepsin-I3 (HMM E-Value=4.1) 26 8.0 SB_19509| Best HMM Match : rve (HMM E-Value=5.4e-26) 26 8.0 >SB_40253| Best HMM Match : Spectrin (HMM E-Value=5.9e-16) Length = 1222 Score = 27.5 bits (58), Expect = 3.5 Identities = 11/37 (29%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = -2 Query: 152 PDALKPSRGATIGIKN-PPMQRTAPPTMLTIRAVKNP 45 P +KP + + G+K+ PP++++ PP + K P Sbjct: 186 PSIIKPVKTSWFGVKSGPPLRQSTPPFYTKLFGTKPP 222 >SB_15448| Best HMM Match : Utp11 (HMM E-Value=0.89) Length = 1328 Score = 27.5 bits (58), Expect = 3.5 Identities = 13/35 (37%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = -2 Query: 176 AAMLPAIIPD-ALKPSRGATIGIKNPPMQRTAPPT 75 +A++ I+ D A P R ++ G + PP++RT PT Sbjct: 93 SALVNIIMQDGAAPPPRPSSAGAELPPLERTGSPT 127 >SB_56776| Best HMM Match : CRA_rpt (HMM E-Value=5.6e-17) Length = 905 Score = 26.6 bits (56), Expect = 6.1 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -1 Query: 159 HYSRCAEAEQRCHDWDQKPSHAKNGSA 79 H S+ AEAE+ C D KP+ A+ A Sbjct: 587 HVSKPAEAEKSCADHLSKPAEAEKSRA 613 >SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4527 Score = 26.2 bits (55), Expect = 8.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -1 Query: 159 HYSRCAEAEQRCHDWDQKPSHAK 91 + S C E EQ C D K +H K Sbjct: 2222 YISSCVETEQSCDDLGPKKTHVK 2244 >SB_27157| Best HMM Match : CLPTM1 (HMM E-Value=0) Length = 1264 Score = 26.2 bits (55), Expect = 8.0 Identities = 14/49 (28%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = -2 Query: 191 YDWAE-AAMLPAIIPDALKPSRGATIGIKNPPMQRTAPPTMLTIRAVKN 48 Y WA A P ++ A KP+ AT + PP P + +V++ Sbjct: 911 YSWANPTATKPKVLTSASKPTSYATKTVPPPPKPTQHPTKSVPASSVRS 959 >SB_24384| Best HMM Match : I-set (HMM E-Value=4.3e-31) Length = 1399 Score = 26.2 bits (55), Expect = 8.0 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -3 Query: 208 PLNSRNTTGLKLQCFPPLFPMR*SRAEVPRLGSKTLPCK 92 P+ ++++ PP F + EVP+ GS TL CK Sbjct: 621 PVGTKSSEAFLKIFVPPSFDVLPKDLEVPQGGSPTLQCK 659 >SB_34017| Best HMM Match : Pepsin-I3 (HMM E-Value=4.1) Length = 153 Score = 26.2 bits (55), Expect = 8.0 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = -1 Query: 177 SCNASRHYSRCAEAEQRCHDWDQKPSHAKNGSAYDVNY 64 +C + Y+R ++ + +D+ Q K G A D+NY Sbjct: 66 TCTRTSQYTRESKPNKIFNDFSQTSKPKKAGIAMDINY 103 >SB_19509| Best HMM Match : rve (HMM E-Value=5.4e-26) Length = 1195 Score = 26.2 bits (55), Expect = 8.0 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +1 Query: 13 LVRSYCDLRIMGFFTALIVNIVGGAVLCMGGFLIPIV 123 LVR D ++ + ALIV+++GG L + + P++ Sbjct: 757 LVRLVSDCLVVSWVIALIVSVIGGVFLLLVVYEEPLM 793 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,799,943 Number of Sequences: 59808 Number of extensions: 238315 Number of successful extensions: 492 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 472 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 492 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 572951758 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -