BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0966 (836 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 24 1.7 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 23 3.0 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 22 5.2 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 9.1 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = -2 Query: 247 NFGSGPL*IVVFASPTLYSSFKEITFVNVGKVNTVFSGS 131 NFG ++F S +Y++ I + K+N + SG+ Sbjct: 170 NFGYTLAKFMIFTSTCIYTNLLRIIEADFSKLNHLLSGT 208 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 23.0 bits (47), Expect = 3.0 Identities = 11/40 (27%), Positives = 20/40 (50%), Gaps = 5/40 (12%) Frame = -3 Query: 702 VCLICE-----FYML*ILPCCLNIRVLVFRYLLLYISISL 598 +C +C+ F + I+ C + +VF + Y SIS+ Sbjct: 523 LCDVCDSVNRIFGFIIIIGCLIQFNTIVFAFCYCYYSISI 562 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 22.2 bits (45), Expect = 5.2 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -1 Query: 386 ITSLESEITILHIKSDFINIFASLIT 309 IT+ S +TI ++ F+ F LIT Sbjct: 1226 ITATSSFVTIHNVIGQFLGYFIGLIT 1251 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.4 bits (43), Expect = 9.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +3 Query: 624 DNERQVLEYLSSKEGSTAYKTHILNK 701 DN + S + G A+KTH L+K Sbjct: 256 DNSNSSEKKSSIQHGDDAHKTHHLDK 281 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,361 Number of Sequences: 336 Number of extensions: 4268 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23036718 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -