BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0959 (380 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370048-1|ABD18609.1| 144|Anopheles gambiae putative secreted ... 25 1.2 AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. 24 1.6 AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. 24 1.6 AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. 24 1.6 AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. 24 1.6 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 24 1.6 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 24 2.2 AY752899-1|AAV30073.1| 43|Anopheles gambiae peroxidase 5B prot... 23 5.0 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 22 6.6 >DQ370048-1|ABD18609.1| 144|Anopheles gambiae putative secreted polypeptide protein. Length = 144 Score = 24.6 bits (51), Expect = 1.2 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 154 GRWCRRWYRPAFGPSTEAESSGDQAGFIRHSA 249 G C + ++ PST A +GD + F H+A Sbjct: 106 GARCTQCSLLSYDPSTHAPDAGDPSYFASHAA 137 >AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 24.2 bits (50), Expect = 1.6 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -3 Query: 135 CDVVEKFFAPFCTARAAGFRARENIFVVCLTC 40 C E FF PFC + A + + C+ C Sbjct: 47 CSCDESFFGPFCETKDGEQPALCSSYEDCIRC 78 >AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 24.2 bits (50), Expect = 1.6 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -3 Query: 135 CDVVEKFFAPFCTARAAGFRARENIFVVCLTC 40 C E FF PFC + A + + C+ C Sbjct: 47 CSCDESFFGPFCETKDGEQPALCSSYEDCIRC 78 >AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 24.2 bits (50), Expect = 1.6 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -3 Query: 135 CDVVEKFFAPFCTARAAGFRARENIFVVCLTC 40 C E FF PFC + A + + C+ C Sbjct: 47 CSCDESFFGPFCETKDGEQPALCSSYEDCIRC 78 >AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 24.2 bits (50), Expect = 1.6 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -3 Query: 135 CDVVEKFFAPFCTARAAGFRARENIFVVCLTC 40 C E FF PFC + A + + C+ C Sbjct: 47 CSCDESFFGPFCETKDGEQPALCSSYEDCIRC 78 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 24.2 bits (50), Expect = 1.6 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -3 Query: 135 CDVVEKFFAPFCTARAAGFRARENIFVVCLTC 40 C E FF PFC + A + + C+ C Sbjct: 623 CSCDESFFGPFCETKDGEQPALCSSYEDCIRC 654 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 23.8 bits (49), Expect = 2.2 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = -1 Query: 275 GRLRRRGSQALCRIKPAWSPEDSASVEGPKAGRYHRRHQRP 153 GRL S AL PA +P + ++ GP G R P Sbjct: 362 GRLPADNSSALNSPNPARAPPRNFTMPGPGPGIGEREKSNP 402 >AY752899-1|AAV30073.1| 43|Anopheles gambiae peroxidase 5B protein. Length = 43 Score = 22.6 bits (46), Expect = 5.0 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -1 Query: 272 RLRRRGSQALCRIKPAWSPE 213 R R +Q LC+ +P W+ E Sbjct: 12 REHNRLAQQLCKARPLWNDE 31 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -3 Query: 237 YKASLVTRGFC 205 YKA LV +GFC Sbjct: 767 YKARLVAQGFC 777 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 463,150 Number of Sequences: 2352 Number of extensions: 10615 Number of successful extensions: 20 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 29074284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -