BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0061 (743 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26160.1 68415.m03139 F-box family protein contains F-box dom... 29 3.3 At4g21600.1 68417.m03128 bifunctional nuclease, putative similar... 28 7.5 >At2g26160.1 68415.m03139 F-box family protein contains F-box domain Pfam:PF00646 Length = 359 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +2 Query: 116 IDLFKYKVIRVNRWYEMSIFKLYIIHG 196 +DL K++V + + YE+ IF Y+I G Sbjct: 112 LDLLKFEVSEIRQSYEIHIFDKYLIQG 138 >At4g21600.1 68417.m03128 bifunctional nuclease, putative similar to bifunctional nuclease [Zinnia elegans] gi|4099833|gb|AAD00694 Length = 296 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/34 (35%), Positives = 23/34 (67%) Frame = +3 Query: 189 FMATNMYVVSESENYRNLINYRFDQIIVFLSTFV 290 F TN ++S SEN +N+++Y + ++FLS ++ Sbjct: 114 FNYTNQ-LMSASENSQNIVHYNLTEALLFLSHYM 146 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,264,477 Number of Sequences: 28952 Number of extensions: 230111 Number of successful extensions: 446 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 442 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 446 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1643603136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -