BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120511.Seq (705 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40737| Best HMM Match : Extensin_2 (HMM E-Value=2.2) 28 6.4 SB_12741| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 >SB_40737| Best HMM Match : Extensin_2 (HMM E-Value=2.2) Length = 409 Score = 28.3 bits (60), Expect = 6.4 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +2 Query: 620 PQVIPITYKTPYHLKLLCLSTFTIFILY 703 P I ITY +PYH+ ++ S + +I+Y Sbjct: 55 PYHIYITYASPYHIYIIYASPYHNYIIY 82 Score = 27.9 bits (59), Expect = 8.5 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = +2 Query: 635 ITYKTPYHLKLLCLSTFTIFILY 703 + Y +PYH ++ ST+ I+I+Y Sbjct: 260 VIYASPYHTYIIYTSTYHIYIIY 282 >SB_12741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 910 Score = 28.3 bits (60), Expect = 6.4 Identities = 11/39 (28%), Positives = 22/39 (56%) Frame = +2 Query: 77 LSASMSNTNDTNA*CVQSLGSRERQMRQYDAMRRDTEPF 193 LS+ M++ N C+QS+ ++++ +DA + E F Sbjct: 96 LSSKMAHDNSPYKHCIQSINVNSQELKYFDASKLGEEAF 134 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,959,050 Number of Sequences: 59808 Number of extensions: 288935 Number of successful extensions: 513 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 475 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 513 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -