BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120499.Seq (816 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 24 1.3 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 23 2.2 AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 23 2.2 AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory recept... 23 2.2 AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 23 2.9 EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 21 8.9 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 24.2 bits (50), Expect = 1.3 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -3 Query: 436 IVIYFYV*LLYHLTCIHLLFC 374 + IY++V L+ L CI+ +C Sbjct: 131 LCIYYFVVPLFFLLCIYYFYC 151 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 23.4 bits (48), Expect = 2.2 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = -3 Query: 394 CIHLLFCFNWLMR 356 C H++F F WL + Sbjct: 116 CTHIIFAFGWLKK 128 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 23.4 bits (48), Expect = 2.2 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = -3 Query: 412 LLYHLTCIHLLFCFNWLM 359 ++Y +L FCF WL+ Sbjct: 315 VIYTFNLFYLCFCFYWLL 332 >AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory receptor candidate 14 protein. Length = 374 Score = 23.4 bits (48), Expect = 2.2 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = -3 Query: 412 LLYHLTCIHLLFCFNWLM 359 ++Y +L FCF WL+ Sbjct: 271 VIYTFNLFYLCFCFYWLL 288 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 23.0 bits (47), Expect = 2.9 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +3 Query: 405 YNNYT*KYITIRVICIHEVIYLFMITRLTKK 497 YNN KY + V C++ I TKK Sbjct: 48 YNNTNRKYYWLNVCCLNLSIVTIFFNFATKK 78 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 21.4 bits (43), Expect = 8.9 Identities = 7/18 (38%), Positives = 8/18 (44%) Frame = +2 Query: 11 HRIHSKISCCDLRFVTVW 64 HR H + C R VW Sbjct: 347 HRCHGNLQSCPTRSHAVW 364 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,001 Number of Sequences: 336 Number of extensions: 4115 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22310335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -