BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021032 (758 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17340| Best HMM Match : 7tm_3 (HMM E-Value=0) 29 4.1 SB_17846| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 >SB_17340| Best HMM Match : 7tm_3 (HMM E-Value=0) Length = 890 Score = 29.1 bits (62), Expect = 4.1 Identities = 21/73 (28%), Positives = 32/73 (43%) Frame = +1 Query: 436 SKNSRHNA*IIARAERD*VGIEQFQFIHVCVRLLMVVSSCYLR*TFFFFYISLSKHRHIR 615 S +NA + + +D + +EQ I V L +V S F I+++ R R Sbjct: 16 SPGDTYNAGGLTKLAKDPLTLEQVASIQSYVGLQLVKLSRLG--LVIFLAIAVTSTRSYR 73 Query: 616 TQFSQRTHIPNYF 654 FS H PNY+ Sbjct: 74 AHFSHANHAPNYY 86 >SB_17846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 27.9 bits (59), Expect = 9.5 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -3 Query: 444 IFRVLNSFHNFIAIRLPSSYVLT 376 I ++L+ FHN + +RLP++ LT Sbjct: 121 IVQLLDDFHNILTVRLPTNLKLT 143 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,611,322 Number of Sequences: 59808 Number of extensions: 359207 Number of successful extensions: 697 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 573 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 696 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2070332524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -