Bombyx BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP20_F_G19
         (891 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo...    27   2.7  
SPCC417.05c |chr2|cfh2|chitin synthase regulatory factor |Schizo...    27   3.6  

>SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31
            |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1224

 Score = 27.5 bits (58), Expect = 2.7
 Identities = 14/49 (28%), Positives = 28/49 (57%)
 Frame = +3

Query: 192  IFKATPPXTSRGTREWEEGRSSALWDRTTMDYSVKPVTTERFSMMTAVS 338
            + ++ PP  SR   + E+ R + L+DR   +   KP+T E  ++ T+++
Sbjct: 1137 VSQSLPPQMSRVVHDTEK-RLNMLFDRLNSNVLSKPLTDELLALATSLN 1184


>SPCC417.05c |chr2|cfh2|chitin synthase regulatory factor
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 512

 Score = 27.1 bits (57), Expect = 3.6
 Identities = 8/12 (66%), Positives = 11/12 (91%)
 Frame = +3

Query: 264 WDRTTMDYSVKP 299
           WDRTT+DY ++P
Sbjct: 14  WDRTTIDYDIEP 25


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,555,790
Number of Sequences: 5004
Number of extensions: 76502
Number of successful extensions: 129
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 125
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 129
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 448490560
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)