BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_D22 (1691 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI00015B4CAB Cluster: PREDICTED: hypothetical protein;... 35 5.5 >UniRef50_UPI00015B4CAB Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 972 Score = 35.1 bits (77), Expect = 5.5 Identities = 22/66 (33%), Positives = 25/66 (37%), Gaps = 3/66 (4%) Frame = +1 Query: 1501 PXXSTPTXXXXDAPLVXXT*QSRRPASXTXXST---PAXXXXAXTPPXCRXPAHPXAXPX 1671 P + P P V T +R P T ST PA PP R P P P Sbjct: 648 PPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPSTYLPPAPPTRPPKPPVTRPPPPPPTRPP 707 Query: 1672 PPPXSR 1689 PPP +R Sbjct: 708 PPPPTR 713 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 785,040,710 Number of Sequences: 1657284 Number of extensions: 8466342 Number of successful extensions: 26225 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 14692 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23635 length of database: 575,637,011 effective HSP length: 105 effective length of database: 401,622,191 effective search space used: 183942963478 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -