BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_D21 (872 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 23 4.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.6 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 9.6 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 9.6 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 22.6 bits (46), Expect = 4.1 Identities = 9/34 (26%), Positives = 17/34 (50%) Frame = -3 Query: 609 ICLRFIIYYHNILKLHYIASLKYISAHVYLITLM 508 IC ++ YH + LKY +Y++T++ Sbjct: 21 ICDSYLKIYHKEKYRKFCRILKYFIIAIYVLTIL 54 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 9.6 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +1 Query: 433 YVLDYIMQFLDYISNYYKEYHSHCLHQSDQV 525 Y + + Q+LD+I+ ++H H Q+ V Sbjct: 2496 YDVPALSQYLDWIAVMTYDFHGHWDKQTGHV 2526 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 9.6 Identities = 7/22 (31%), Positives = 16/22 (72%) Frame = +2 Query: 413 NCIRHFYMYSITLCNSSIILVI 478 NC+++ +Y +T+ + ++LVI Sbjct: 1000 NCLKYGVIYYVTVPSMYLLLVI 1021 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 9.6 Identities = 7/22 (31%), Positives = 16/22 (72%) Frame = +2 Query: 413 NCIRHFYMYSITLCNSSIILVI 478 NC+++ +Y +T+ + ++LVI Sbjct: 1000 NCLKYGVIYYVTVPSMYLLLVI 1021 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,132 Number of Sequences: 336 Number of extensions: 2641 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24099889 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -